BP920892
Clone id YMU001_000143_A08
Library
Length 332
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000143_A08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAAATTCAACACTAAGACCCTCTCTTAAATGAAGTGGTAGTGCACCTCAATGTGATTTC
TCCTCACAAGTGGTAGACCTACGATCGTATGTTCTATGAGCCCCATCCACATTTGTGTAA
CCAGAGAGTTGCATCTCAACAACAATCCTATAAAAGAGTGCATAATCCACAGTACCACTC
ACATAGCATAATGTGTGCCTCACTGCATCCAACGTGGAGTTTCCTAATATTGCATAAACT
AACTCACCAATCCAATTGTGTAGCTCAAGTCTTGATGTGAGATGTGTATGTTGATCAAGC
TACCAACCATCTTCGTATGCATGAATGCATTC
■■Homology search results ■■ -
sp_hit_id P93290
Definition sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana
Align length 48
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920892|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_A08.
(332 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg0... 35 0.15
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 34 0.26
sp|Q6BKH3|DBP7_DEBHA ATP-dependent RNA helicase DBP7 OS=Debaryom... 31 2.2
sp|P34314|TLK1_CAEEL Serine/threonine-protein kinase tousled-lik... 30 4.9
sp|A1S4M2|SYDP_SHEAM Protein syd OS=Shewanella amazonensis (stra... 30 4.9
sp|Q20618|SRA13_CAEEL Serpentine receptor class alpha-13 OS=Caen... 30 4.9
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg0... 30 4.9
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=... 29 6.4
sp|Q6ZQV5|ZN788_HUMAN Zinc finger protein 788 OS=Homo sapiens GN... 29 6.4
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Pichia g... 29 8.4
sp|P67766|CYSE_STAAW Serine acetyltransferase OS=Staphylococcus ... 29 8.4
sp|Q6GBV9|CYSE_STAAS Serine acetyltransferase OS=Staphylococcus ... 29 8.4
sp|Q6GJE0|CYSE_STAAR Serine acetyltransferase OS=Staphylococcus ... 29 8.4
sp|P67765|CYSE_STAAN Serine acetyltransferase OS=Staphylococcus ... 29 8.4
sp|P67764|CYSE_STAAM Serine acetyltransferase OS=Staphylococcus ... 29 8.4
sp|Q5HIE6|CYSE_STAAC Serine acetyltransferase OS=Staphylococcus ... 29 8.4

>sp|P93290|M240_ARATH Uncharacterized mitochondrial protein
AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1
Length = 111

Score = 34.7 bits (78), Expect = 0.15
Identities = 19/48 (39%), Positives = 24/48 (50%)
Frame = -1

Query: 212 LDAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
+ AV L YV GTV LFY ++QL + + D A RRS T
Sbjct: 29 MQAVYKVLHYVKGTVGQGLFYSATSDLQLKAFADSDWASCPDTRRSVT 76


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP
PE=1 SV=3
Length = 1409

Score = 33.9 bits (76), Expect = 0.26
Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
Frame = -1

Query: 236 YAILGNSTL-DAVRHTLCYVSGTVDYALFYR--IVVEMQLSGYTNVDGAHRTYDRRSTT 69
Y+ NS L ++ L Y+ GT+D L ++ + E ++ GY + D A DR+STT
Sbjct: 1209 YSSKNNSELWQNLKRVLRYLKGTIDMKLIFKKNLAFENKIIGYVDSDWAGSEIDRKSTT 1267


>sp|Q6BKH3|DBP7_DEBHA ATP-dependent RNA helicase DBP7
OS=Debaryomyces hansenii GN=DBP7 PE=3 SV=1
Length = 798

Score = 30.8 bits (68), Expect = 2.2
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 8/48 (16%)
Frame = -3

Query: 327 HSCIRRWLVA*ST--------YTSHIKT*ATQLDW*VSLCNIRKLHVG 208
H + RWL+ ST +TSHI+ AT L S N++ LH+G
Sbjct: 691 HLDVERWLLEDSTAHDRAVQAFTSHIRAYATHLSTERSFFNVKLLHLG 738


>sp|P34314|TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1
OS=Caenorhabditis elegans GN=tlk-1 PE=1 SV=3
Length = 965

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/43 (27%), Positives = 22/43 (51%)
Frame = +2

Query: 80 YDRMFYEPHPHLCNQRVASQQQSYKRVHNPQYHSHSIMCASLH 208
Y+ + HPH ++ QQQ +++ +N YH+H +H
Sbjct: 141 YNSGVHHMHPH--QMQMQQQQQHHQQQYNMSYHNHQQQMQQMH 181


>sp|A1S4M2|SYDP_SHEAM Protein syd OS=Shewanella amazonensis (strain
ATCC BAA-1098 / SB2B) GN=syd PE=3 SV=1
Length = 215

Score = 29.6 bits (65), Expect = 4.9
Identities = 15/38 (39%), Positives = 16/38 (42%)
Frame = +2

Query: 98 EPHPHLCNQRVASQQQSYKRVHNPQYHSHSIMCASLHP 211
EPH L A QQ RV PQYH + HP
Sbjct: 162 EPHEQLAESLEAFLQQLKPRVAPPQYHQEPAATVNPHP 199


>sp|Q20618|SRA13_CAEEL Serpentine receptor class alpha-13
OS=Caenorhabditis elegans GN=sra-13 PE=2 SV=2
Length = 335

Score = 29.6 bits (65), Expect = 4.9
Identities = 11/38 (28%), Positives = 24/38 (63%)
Frame = -1

Query: 194 TLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDR 81
TL ++ ++ +++F+ + ++ LSGY N G + TY +
Sbjct: 151 TLALITLSISFSMFFILTIDDPLSGYVNHCGFYPTYSQ 188


>sp|P92519|M810_ARATH Uncharacterized mitochondrial protein
AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1
Length = 240

Score = 29.6 bits (65), Expect = 4.9
Identities = 15/47 (31%), Positives = 25/47 (53%)
Frame = -1

Query: 209 DAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
D ++ L YV GT+ + L+ ++ + + + D A T RRSTT
Sbjct: 137 DLLKRVLRYVKGTIFHGLYIHKNSKLNVQAFCDSDWAGCTSTRRSTT 183


>sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens
GN=ZNF20 PE=2 SV=2
Length = 532

Score = 29.3 bits (64), Expect = 6.4
Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%)
Frame = +2

Query: 80 YDRMFYEPHPHLCNQ-----RVASQQQSYKRVHNPQYHSHSIMCASLHPTWSFLILHKLT 244
+++ E P+ C Q R ASQ Q ++R H+ + C + +S L +H+ T
Sbjct: 357 HEKTHTEDKPYGCKQCGKGFRCASQLQIHERTHSGEKPHECKECGKVFKYFSSLRIHERT 416

Query: 245 H 247
H
Sbjct: 417 H 417


>sp|Q6ZQV5|ZN788_HUMAN Zinc finger protein 788 OS=Homo sapiens
GN=ZNF788 PE=2 SV=2
Length = 615

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
Frame = +2

Query: 107 PHLCNQ-----RVASQQQSYKRVHNPQYHSHSIMCASLHPTWSFLILHKLTH 247
PH C Q R AS + + R H + C + WS L +H++TH
Sbjct: 195 PHECKQCGKTFRCASSLRIHGRTHTGEKPYECKQCGKVSRYWSGLQVHEVTH 246



Score = 29.3 bits (64), Expect = 6.4
Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
Frame = +2

Query: 107 PHLCNQ-----RVASQQQSYKRVHNPQYHSHSIMCASLHPTWSFLILHKLTH 247
P+ C Q R AS ++++R H + C ++ WS L +H LTH
Sbjct: 473 PYECKQCGRAFRSASHLRTHERTHIGEKPYECKQCGKVYRYWSGLRIHGLTH 524


>sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Pichia
guilliermondii GN=DBP7 PE=3 SV=3
Length = 747

Score = 28.9 bits (63), Expect = 8.4
Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 8/48 (16%)
Frame = -3

Query: 327 HSCIRRWLV--------A*STYTSHIKT*ATQLDW*VSLCNIRKLHVG 208
H I RWL+ A +TSHI+ AT L + N++ LH+G
Sbjct: 640 HLDIERWLLEDAASHESAKQAFTSHIRAYATHLSSEKTFFNVKTLHLG 687


tr_hit_id A5C7V7
Definition tr|A5C7V7|A5C7V7_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 52
Score (bit) 39.7
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920892|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_A08.
(332 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5C7V7|A5C7V7_VITVI Putative uncharacterized protein OS=Vitis... 40 2e-09
tr|A5BGK7|A5BGK7_VITVI Putative uncharacterized protein OS=Vitis... 41 1e-06
tr|A5C788|A5C788_VITVI Putative uncharacterized protein OS=Vitis... 40 4e-06
tr|A5AKW8|A5AKW8_VITVI Putative uncharacterized protein OS=Vitis... 40 5e-06
tr|A5C6M9|A5C6M9_VITVI Putative uncharacterized protein OS=Vitis... 34 4e-04
tr|A5BN86|A5BN86_VITVI Putative uncharacterized protein OS=Vitis... 34 0.001
tr|A5AF15|A5AF15_VITVI Putative uncharacterized protein OS=Vitis... 34 0.001
tr|A5BCZ7|A5BCZ7_VITVI Putative uncharacterized protein OS=Vitis... 33 0.004
tr|Q8L4X0|Q8L4X0_ORYSJ Os10g0130700 protein OS=Oryza sativa subs... 35 0.004
tr|Q01KU7|Q01KU7_ORYSA OSIGBa0115A19.5 protein OS=Oryza sativa G... 35 0.004
tr|Q10RM4|Q10RM4_ORYSJ Retrotransposon protein, putative, unclas... 37 0.004
tr|Q10K27|Q10K27_ORYSJ Retrotransposon protein, putative, Ty1-co... 37 0.004
tr|Q84MV7|Q84MV7_ORYSJ Retrotransposon protein, putative, unclas... 37 0.004
tr|Q0J5Y3|Q0J5Y3_ORYSJ Os08g0389500 protein OS=Oryza sativa subs... 39 0.007
tr|Q9C5V1|Q9C5V1_ARATH Gag/pol polyprotein OS=Arabidopsis thalia... 40 0.015
tr|Q6L3Y5|Q6L3Y5_SOLDE Gag-pol polyprotein, putative OS=Solanum ... 42 0.016
tr|A5ADY5|A5ADY5_VITVI Putative uncharacterized protein OS=Vitis... 30 0.020
tr|Q25AF6|Q25AF6_ORYSA H0512B01.8 protein OS=Oryza sativa GN=H05... 34 0.025
tr|Q19PL0|Q19PL0_POPTR NBS type disease resistance protein OS=Po... 35 0.026
tr|A5BGI8|A5BGI8_VITVI Putative uncharacterized protein OS=Vitis... 41 0.026
tr|Q0J867|Q0J867_ORYSJ Os08g0133100 protein (Fragment) OS=Oryza ... 34 0.027
tr|A5APK3|A5APK3_VITVI Putative uncharacterized protein OS=Vitis... 32 0.031
tr|A5AGK3|A5AGK3_VITVI Putative uncharacterized protein OS=Vitis... 30 0.033
tr|A5B9Y8|A5B9Y8_VITVI Putative uncharacterized protein OS=Vitis... 33 0.033
tr|A5BJM5|A5BJM5_VITVI Putative uncharacterized protein OS=Vitis... 30 0.033
tr|Q25AG1|Q25AG1_ORYSA H0512B01.3 protein OS=Oryza sativa GN=H05... 36 0.033
tr|A5BS15|A5BS15_VITVI Putative uncharacterized protein OS=Vitis... 30 0.035
tr|A5BJM6|A5BJM6_VITVI Putative uncharacterized protein OS=Vitis... 30 0.035
tr|A5B4J1|A5B4J1_VITVI Putative uncharacterized protein OS=Vitis... 30 0.035
tr|A5AUU6|A5AUU6_VITVI Putative uncharacterized protein OS=Vitis... 30 0.035

>tr|A5C7V7|A5C7V7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041885 PE=4 SV=1
Length = 408

Score = 39.7 bits (91), Expect(3) = 2e-09
Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
Frame = -1

Query: 218 STLDAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVD--GAHRTYDRRSTT 69
S L+A+R L +V GT+DY L Y+ + +L GY + D G H T+ RSTT
Sbjct: 258 SHLEAIRQILRHVKGTIDYGLLYKKGEDCKLVGYCDADYVGDHDTH--RSTT 307



Score = 33.5 bits (75), Expect(3) = 2e-09
Identities = 13/34 (38%), Positives = 26/34 (76%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQ 230
+A M+ ++VGSL+ + ++ D+SY +G++S +MQ
Sbjct: 220 DATMYRQLVGSLLYLTLTRPDISYAVGVMSRYMQ 253



Score = 30.8 bits (68), Expect(3) = 2e-09
Identities = 12/17 (70%), Positives = 14/17 (82%)
Frame = -2

Query: 64 RRNHIEVHYHFI*ERVL 14
R H+EVHYHFI E+VL
Sbjct: 343 RTKHVEVHYHFIREKVL 359


>tr|A5BGK7|A5BGK7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007301 PE=4 SV=1
Length = 973

Score = 41.2 bits (95), Expect(2) = 1e-06
Identities = 22/48 (45%), Positives = 29/48 (60%)
Frame = -1

Query: 212 LDAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
L+AVR L +V GT+DY L Y+ + +L GY + D A RRSTT
Sbjct: 782 LEAVRRILRHVKGTIDYGLLYKKGEDCKLVGYCDADYAGDHDTRRSTT 829



Score = 34.3 bits (77), Expect(2) = 1e-06
Identities = 14/39 (35%), Positives = 28/39 (71%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETP 215
+A M+ ++VGSL+ + ++ D+SY +G++S +MQ + P
Sbjct: 742 DATMYRQLVGSLVYLTLTRPDISYAVGVMSRYMQNPKKP 780


>tr|A5C788|A5C788_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026292 PE=4 SV=1
Length = 1161

Score = 40.4 bits (93), Expect(2) = 4e-06
Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
Frame = -1

Query: 212 LDAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVD--GAHRTYDRRSTT 69
L+AVR L +V GT+DY L Y+ + +L GY + D G H T RRSTT
Sbjct: 1036 LEAVRRILRHVKGTIDYGLLYKKGEDYKLVGYCDADYVGDHDT--RRSTT 1083



Score = 33.1 bits (74), Expect(2) = 4e-06
Identities = 14/39 (35%), Positives = 27/39 (69%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETP 215
+A M+ ++VGSL+ + + D+SY +G++S +MQ + P
Sbjct: 996 DATMYRQLVGSLLYLTFTRTDISYAVGVMSRYMQNPKKP 1034


>tr|A5AKW8|A5AKW8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027864 PE=4 SV=1
Length = 1300

Score = 39.7 bits (91), Expect(2) = 5e-06
Identities = 21/48 (43%), Positives = 28/48 (58%)
Frame = -1

Query: 212 LDAVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
L+AVR L +V GT+DY L Y+ + +L GY + D A R STT
Sbjct: 1109 LEAVRRILRHVKGTIDYGLLYKKXEDCKLVGYCDADYAGDHDTRXSTT 1156



Score = 33.5 bits (75), Expect(2) = 5e-06
Identities = 14/39 (35%), Positives = 28/39 (71%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETP 215
+A M+ ++VGSL+ + ++ D+SY +G++S +MQ + P
Sbjct: 1069 DATMYRQLVGSLLYLTLTXPDISYAVGVMSRYMQNPKKP 1107


>tr|A5C6M9|A5C6M9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015847 PE=4 SV=1
Length = 1168

Score = 33.9 bits (76), Expect(2) = 4e-04
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = -1

Query: 206 AVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
AV L Y+ GT+ + LFY + L +++ D A DRRSTT
Sbjct: 986 AVLRILRYLKGTIFHGLFYSAQSPLVLRAFSDADWAGDPTDRRSTT 1031



Score = 32.7 bits (73), Expect(2) = 4e-04
Identities = 18/49 (36%), Positives = 28/49 (57%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRWMQ*GTHYA 185
N ++ ++VGSL+ + ++ D+SY + VS QY PR THYA
Sbjct: 944 NPSLYRRLVGSLVYLTVTRPDISYVVHQVS---QYLSAPR----STHYA 985


>tr|A5BN86|A5BN86_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033646 PE=4 SV=1
Length = 1013

Score = 33.9 bits (76), Expect(2) = 0.001
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = -1

Query: 206 AVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
AV L Y+ GT+ + LFY + L +++ D A DRRSTT
Sbjct: 831 AVLRILRYLKGTIFHGLFYSAQSPLVLRAFSDADWAGDPTDRRSTT 876



Score = 31.6 bits (70), Expect(2) = 0.001
Identities = 17/49 (34%), Positives = 28/49 (57%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRWMQ*GTHYA 185
N ++ ++VG+L+ + ++ D+SY + VS QY PR THYA
Sbjct: 789 NPSLYRRLVGNLVYLTVTRPDISYAVHQVS---QYLSAPR----STHYA 830


>tr|A5AF15|A5AF15_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_021305 PE=4 SV=1
Length = 1287

Score = 34.3 bits (77), Expect(2) = 0.001
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = -1

Query: 206 AVRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
AV L Y+ GT+ + LFY + L +++ D A DRRSTT
Sbjct: 1105 AVLRILRYLKGTIFHGLFYSAQSPLVLRAFSDADWAGDPXDRRSTT 1150



Score = 30.8 bits (68), Expect(2) = 0.001
Identities = 17/48 (35%), Positives = 27/48 (56%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRWMQ*GTHY 188
N ++ ++VGSL+ + ++ D+SY + VS QY PR THY
Sbjct: 1063 NPSLYRRLVGSLVCLTVTRPDISYAVHQVS---QYLSAPR----STHY 1103


>tr|A5BCZ7|A5BCZ7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_010987 PE=4 SV=1
Length = 2471

Score = 32.7 bits (73), Expect(2) = 0.004
Identities = 18/49 (36%), Positives = 28/49 (57%)
Frame = -2

Query: 331 NAFMHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRWMQ*GTHYA 185
N ++ ++VGSL+ + ++ D+SY + VS QY PR THYA
Sbjct: 1404 NPSLYRRLVGSLVYLTVTRPDISYVVHQVS---QYLSAPR----STHYA 1445



Score = 30.4 bits (67), Expect(2) = 0.004
Identities = 16/45 (35%), Positives = 24/45 (53%)
Frame = -1

Query: 203 VRHTLCYVSGTVDYALFYRIVVEMQLSGYTNVDGAHRTYDRRSTT 69
V L Y+ GT+ + LFY + L +++ D A +RRSTT
Sbjct: 1447 VLRILRYLKGTIFHGLFYSAQSPLVLRAFSDADWAGDPTNRRSTT 1491


>tr|Q8L4X0|Q8L4X0_ORYSJ Os10g0130700 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0072F04.17 PE=4 SV=1
Length = 1426

Score = 34.7 bits (78), Expect(2) = 0.004
Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 2/48 (4%)
Frame = -1

Query: 206 AVRHTLCYVSGTVDYALFY--RIVVEMQLSGYTNVDGAHRTYDRRSTT 69
AV+H L Y++GT+D ++ R E++L G+++ D A DR+STT
Sbjct: 1241 AVKHILRYIAGTLDVGCWFGRREKGELRLIGFSDSDMAGDLDDRKSTT 1288



Score = 28.5 bits (62), Expect(2) = 0.004
Identities = 14/38 (36%), Positives = 22/38 (57%)
Frame = -2

Query: 322 MHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRW 209
M+ VGSL + + DL+Y++G VS FM+ + W
Sbjct: 1202 MYRSTVGSLRYLVNTRPDLAYSVGYVSRFMEKPTSEHW 1239


>tr|Q01KU7|Q01KU7_ORYSA OSIGBa0115A19.5 protein OS=Oryza sativa
GN=OSIGBa0115A19.5 PE=4 SV=1
Length = 1426

Score = 34.7 bits (78), Expect(2) = 0.004
Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 2/48 (4%)
Frame = -1

Query: 206 AVRHTLCYVSGTVDYALFY--RIVVEMQLSGYTNVDGAHRTYDRRSTT 69
AV+H L Y++GT+D ++ R E++L G+++ D A DR+STT
Sbjct: 1241 AVKHILRYIAGTLDVGCWFGRREKGELRLIGFSDSDMAGDLDDRKSTT 1288



Score = 28.5 bits (62), Expect(2) = 0.004
Identities = 14/38 (36%), Positives = 22/38 (57%)
Frame = -2

Query: 322 MHTKMVGSLINIHISHQDLSYTIGLVS*FMQY*ETPRW 209
M+ VGSL + + DL+Y++G VS FM+ + W
Sbjct: 1202 MYRSTVGSLRYLVNTRPDLAYSVGYVSRFMEKPTSEHW 1239