BP920922
Clone id YMU001_000143_D08
Library
Length 599
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000143_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGGGATATCGTGTGCCAGATTATCATTGCTGATGGAAGCAACAATACCCGTATGAGGGT
CCTCTCCATCTACATCAAAAACTTTAAACTCCGGACCAAAGTCACAAAACACACTTCCAA
AAAGTCCATGAATATCCGCCTTAATAAATGCAACAGGTGGGGTTTGATTGCGGCAGTAGT
TGTCATACGTACAAGCTTGTTCAAGAGTAGCATTTGTTAACACAACAGCCTGGAACCCAG
ACAGAAACTCTGTTGTTATTTCTGATGTATAGACATTAACAGATACTGCTGTATTCAACT
CTTGTAATTTACTGACACAGGCAAGTGCTCTATTCTTCCCTACATCAGCTTCTGATAAAC
AAAAGTTTCCCCCGAGGTCCCACAAATCCATAATACCAGTGTCATGAAGCACCACAGATT
TGACTCCAGCCAAGATTATGTTCTTTGCTATTTCAACTCCAAGACCTTGGATGCCTGAAA
TGAGAACATTTGCACCAAAAAGCCGACGCATCGTTTCTCTGCCATACACGGCAAGCTGCC
GACTGTGCAAATCTTCATCAATATCCATTTCGGATGGGCTCCCATTTGATGACATAGCC
■■Homology search results ■■ -
sp_hit_id P20973
Definition sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum
Align length 195
Score (bit) 274.0
E-value 2.0e-73
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920922|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_D08.
(599 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Tritic... 274 2e-73
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Tritic... 270 5e-72
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Tritic... 266 8e-71
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1... 181 3e-45
sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme ... 180 6e-45
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 O... 178 2e-44
sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1... 178 2e-44
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1... 175 2e-43
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1... 173 5e-43
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizos... 160 6e-39
sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6... 157 4e-38
sp|Q8C7R4|UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6... 152 1e-36
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Sacchar... 147 4e-35
sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7... 145 2e-34
sp|Q55C16|UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1... 142 1e-33
sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus no... 97 8e-20
sp|Q9R1T2|SAE1_MOUSE SUMO-activating enzyme subunit 1 OS=Mus mus... 94 4e-19
sp|Q5NVN7|SAE1_PONAB SUMO-activating enzyme subunit 1 OS=Pongo a... 94 7e-19
sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sa... 94 7e-19
sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos tau... 93 1e-18
sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus... 92 2e-18
sp|Q28DS0|SAE1_XENTR SUMO-activating enzyme subunit 1 OS=Xenopus... 92 3e-18
sp|Q54WI4|SAE1_DICDI SUMO-activating enzyme subunit 1 OS=Dictyos... 89 2e-17
sp|Q6IQS6|SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio r... 82 2e-15
sp|Q17820|SAE1_CAEEL SUMO-activating enzyme subunit aos-1 OS=Cae... 70 8e-12
sp|Q18217|ULA1_CAEEL NEDD8-activating enzyme E1 regulatory subun... 70 1e-11
sp|Q06624|RHC31_YEAST DNA damage tolerance protein RHC31 OS=Sacc... 69 2e-11
sp|P79064|RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schi... 68 4e-11
sp|Q8VBW6|ULA1_MOUSE NEDD8-activating enzyme E1 regulatory subun... 65 2e-10
sp|P42744|ULA1_ARATH NEDD8-activating enzyme E1 regulatory subun... 65 3e-10

>sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum
aestivum GN=UBA1 PE=1 SV=1
Length = 1051

Score = 274 bits (701), Expect = 2e-73
Identities = 134/195 (68%), Positives = 161/195 (82%)
Frame = -2

Query: 598 AMSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK 419
AM+ G+ +IDEDLHSRQLAVYGRETM+RLFG+NVL+SG+QGLG EIAKN++LAGVK
Sbjct: 35 AMAGRGN----EIDEDLHSRQLAVYGRETMKRLFGSNVLVSGLQGLGAEIAKNLVLAGVK 90

Query: 418 SVVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLS 239
SV LHD G ++LWDL NF LSE DVG+NRA ACV KLQELN AV V+ T ++T E LS
Sbjct: 91 SVTLHDDGNVELWDLSSNFFLSENDVGQNRAQACVQKLQELNNAVLVSALTGDLTKEHLS 150

Query: 238 GFQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGED 59
FQAVV T+ +L++A +D+YC +Q PP+AFIK+++ GLFGSVFCDFGPEF V DVDGE+
Sbjct: 151 KFQAVVFTDISLDKAIEFDDYCHSQQPPIAFIKSEVRGLFGSVFCDFGPEFTVLDVDGEE 210

Query: 58 PHTGIVASISNDNLA 14
PHTGIVASISNDN A
Sbjct: 211 PHTGIVASISNDNPA 225



Score = 40.4 bits (93), Expect = 0.007
Identities = 31/150 (20%), Positives = 62/150 (41%), Gaps = 19/150 (12%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SV 413
P ++ + Q++V+G + +L A + + G LG E KN+ L G+ ++
Sbjct: 435 PGDLKPKNSRYDAQISVFGSKLQNKLEEAKIFMVGSGALGCEFLKNLALMGISCSQNGNL 494

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE----- 248
L D +++ +L F + ++G+ ++ + +N + V + + E
Sbjct: 495 TLTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMVINPKLHVEALQNRASPETENVF 554

Query: 247 ---FLSGFQAVV--LTNAT----LEQACTY 185
F AVV L N T ++ C Y
Sbjct: 555 NDAFWENLDAVVNALDNVTARMYIDSRCVY 584


>sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum
aestivum GN=UBA2 PE=2 SV=1
Length = 1051

Score = 270 bits (689), Expect = 5e-72
Identities = 132/195 (67%), Positives = 159/195 (81%)
Frame = -2

Query: 598 AMSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK 419
AM+ G+ +IDEDLHSRQLAVYGRETM+ LFG+NVL+SG+QGLG EIAKN++LAGVK
Sbjct: 35 AMAGRGN----EIDEDLHSRQLAVYGRETMKPLFGSNVLVSGLQGLGAEIAKNLVLAGVK 90

Query: 418 SVVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLS 239
SV LHD G ++LWDL NF LSE DVG+NRA ACV KLQELN AV V+ T ++T E LS
Sbjct: 91 SVTLHDDGNVELWDLSSNFFLSENDVGQNRAQACVQKLQELNNAVLVSALTGDLTKEHLS 150

Query: 238 GFQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGED 59
FQAVV T+ +L++A +D+YC + PP+AFIK+++ GLFGSVFCDFGPEF V DVDGE+
Sbjct: 151 KFQAVVFTDISLDKAIEFDDYCHSHQPPIAFIKSEVRGLFGSVFCDFGPEFTVLDVDGEE 210

Query: 58 PHTGIVASISNDNLA 14
PHTGIVASISNDN A
Sbjct: 211 PHTGIVASISNDNPA 225



Score = 38.5 bits (88), Expect = 0.026
Identities = 30/150 (20%), Positives = 61/150 (40%), Gaps = 19/150 (12%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SV 413
P ++ + Q++V+G +L A + + G LG E KN+ L G+ ++
Sbjct: 435 PGDLKPKNSRYDAQISVFGSTLQNKLEEAKIFMVGSGALGCEFLKNLALMGISCSQNGNL 494

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE----- 248
+ D +++ +L F + ++G+ ++ + +N + V + + E
Sbjct: 495 TVTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMVINPKLHVEALQNRASPETENVF 554

Query: 247 ---FLSGFQAVV--LTNAT----LEQACTY 185
F AVV L N T ++ C Y
Sbjct: 555 NDAFWENLDAVVNALDNVTARMYIDSRCVY 584


>sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum
aestivum GN=UBA3 PE=2 SV=1
Length = 1053

Score = 266 bits (679), Expect = 8e-71
Identities = 126/184 (68%), Positives = 152/184 (82%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
+IDEDLHSRQLAVYGRETMRRLF ++VL+SG+ GLG EIAKN+ LAGVKSV +HD +
Sbjct: 45 EIDEDLHSRQLAVYGRETMRRLFASDVLVSGLNGLGAEIAKNLALAGVKSVTIHDVKTVK 104

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
+WDL GNF LSE D+GKNRA ACV+KLQELN AV ++ T E+TTE LS FQAVV T+
Sbjct: 105 MWDLSGNFFLSEDDIGKNRAAACVAKLQELNNAVLISALTEELTTEHLSKFQAVVFTDID 164

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
L++A +D+YC N PP++FIK+++ GLFGSVFCDFGP+F V DVDGEDPHTGI+ASISN
Sbjct: 165 LDKAYEFDDYCHNHQPPISFIKSEVCGLFGSVFCDFGPKFTVLDVDGEDPHTGIIASISN 224

Query: 25 DNLA 14
DN A
Sbjct: 225 DNPA 228



Score = 41.6 bits (96), Expect = 0.003
Identities = 21/106 (19%), Positives = 51/106 (48%), Gaps = 5/106 (4%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SV 413
P ++ + + Q++V+G + +++ AN + G LG E KN+ L GV +
Sbjct: 438 PQDLKPSNNRYDAQVSVFGSKLQKKMEEANTFVVGSGALGCEFLKNLALMGVSCSSKGKL 497

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVN 275
+ D I++ +L F + ++G+ ++ + +N ++ ++
Sbjct: 498 TITDDDIIEKSNLSRQFLFRDWNIGQAKSTVAATAASAINPSLHID 543


>sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1
OS=Homo sapiens GN=UBA1 PE=1 SV=3
Length = 1058

Score = 181 bits (458), Expect = 3e-45
Identities = 97/192 (50%), Positives = 123/192 (64%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
M+ NGS E DIDE L+SRQL V G E M+RL ++VL+SG++GLGVEIAKNIIL GVK+
Sbjct: 41 MAKNGS--EADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKA 98

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
V LHD G DL F L E D+GKNRA +L ELN+ V V YT + +FLSG
Sbjct: 99 VTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSG 158

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQ VVLTN LE +C N+ + + AD GLFG +FCDFG E + D +GE P
Sbjct: 159 FQVVVLTNTPLEDQLRVGEFCHNR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQP 216

Query: 55 HTGIVASISNDN 20
+ +V+ ++ DN
Sbjct: 217 LSAMVSMVTKDN 228


>sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y
OS=Mus musculus GN=Ube1ay PE=2 SV=2
Length = 1058

Score = 180 bits (456), Expect = 6e-45
Identities = 99/192 (51%), Positives = 121/192 (63%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
MS N EMDIDE L+SRQL V G E M+ L ++VLISG+QGLGVEIAKNIIL GVK+
Sbjct: 41 MSKN---KEMDIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKA 97

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
V LHD GI DL FCL E D+GKNRA +L ELN+ V V YT + EFLSG
Sbjct: 98 VTLHDQGIAQWADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSG 157

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQ VVLTN LE +C + + + AD GL G +FCDFG E + D +GE P
Sbjct: 158 FQVVVLTNTPLEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQP 215

Query: 55 HTGIVASISNDN 20
+ +V+ I+ +N
Sbjct: 216 LSAMVSMITKEN 227


>sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1
OS=Rattus norvegicus GN=Uba1 PE=1 SV=1
Length = 1058

Score = 178 bits (452), Expect = 2e-44
Identities = 95/192 (49%), Positives = 124/192 (64%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
M+ NGS E DIDE L+SRQL V G E M+ L ++VL+SG++GLGVEIAKNIIL GVK+
Sbjct: 41 MAKNGS--EADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVKA 98

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
V LHD G DL F L E D+GKNRA +L ELN+ V V YT + +FLSG
Sbjct: 99 VTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSG 158

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQ VVLTN+ LE+ +C ++ + + AD GLFG +FCDFG E + D +GE P
Sbjct: 159 FQVVVLTNSPLEEQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQP 216

Query: 55 HTGIVASISNDN 20
+ +V+ ++ DN
Sbjct: 217 LSAMVSMVTKDN 228


>sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1
OS=Oryctolagus cuniculus GN=UBA1 PE=2 SV=1
Length = 1058

Score = 178 bits (452), Expect = 2e-44
Identities = 96/192 (50%), Positives = 124/192 (64%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
M+ NGS E DIDE L+SRQL V G E M+RL ++VL+SG++GLGVEIAKNIIL GVK+
Sbjct: 41 MAKNGS--EADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKA 98

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
V LHD G DL F L E D+GKNRA +L ELN+ V V YT + +FLSG
Sbjct: 99 VTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSG 158

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQ VVLTN+ LE +C ++ + + AD GLFG +FCDFG E + D +GE P
Sbjct: 159 FQVVVLTNSPLEDQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQP 216

Query: 55 HTGIVASISNDN 20
+ +V+ ++ DN
Sbjct: 217 LSTMVSMVTKDN 228


>sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1
OS=Mus musculus GN=Uba1 PE=1 SV=1
Length = 1058

Score = 175 bits (443), Expect = 2e-43
Identities = 94/192 (48%), Positives = 122/192 (63%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
M+ NGS E DIDE L+SRQL V G E M+ L ++VL+SG++GLGVEIAKNIIL GVK+
Sbjct: 41 MAKNGS--EADIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVKA 98

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
V LHD G DL F L E D+GKNRA +L ELN+ V V YT + +FLS
Sbjct: 99 VTLHDQGTTQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSS 158

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQ VVLTN+ LE +C ++ + + AD GLFG +FCDFG E + D +GE P
Sbjct: 159 FQVVVLTNSPLEAQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQP 216

Query: 55 HTGIVASISNDN 20
+ +V+ ++ DN
Sbjct: 217 LSAMVSMVTKDN 228


>sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1
OS=Bos taurus GN=UBA1 PE=2 SV=1
Length = 1058

Score = 173 bits (439), Expect = 5e-43
Identities = 91/185 (49%), Positives = 119/185 (64%)
Frame = -2

Query: 574 SEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTG 395
S+ DIDE L+SRQL V G E M+RL ++VL+SG++GLGVEIAKNIIL GVK+V LHD G
Sbjct: 46 SDADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQG 105

Query: 394 IMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLT 215
DL F L E D+GKNRA +L ELN+ V V+ YT + +FLS FQ VVLT
Sbjct: 106 TAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVSAYTGPLVEDFLSDFQVVVLT 165

Query: 214 NATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVAS 35
N+ LE +C + + + AD GLFG +FCDFG E + D +GE P + +V+
Sbjct: 166 NSPLEDQLRVGEFCHSH--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSM 223

Query: 34 ISNDN 20
++ DN
Sbjct: 224 VTKDN 228


>sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1
OS=Schizosaccharomyces pombe GN=ptr3 PE=1 SV=1
Length = 1012

Score = 160 bits (404), Expect = 6e-39
Identities = 91/196 (46%), Positives = 126/196 (64%), Gaps = 3/196 (1%)
Frame = -2

Query: 595 MSSNGSPSEMD---IDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG 425
MS+N + + D IDE L+SRQL V G E M+++ +NVLI G +GLGVEIAKN+ LAG
Sbjct: 1 MSNNMNIDQTDQNTIDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAG 60

Query: 424 VKSVVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEF 245
VKSV L+D + DL + L+E D+G RA VSKL ELN V V+V E++TE+
Sbjct: 61 VKSVTLYDPQPTRIEDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVSV-VDELSTEY 119

Query: 244 LSGFQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDG 65
L F+ VV+T +L + +++ +A+I AD GLFGS+FCDFG F D DG
Sbjct: 120 LKNFKCVVVTETSLTKQLEINDFTHKN--HIAYIAADSRGLFGSIFCDFGENFICTDTDG 177

Query: 64 EDPHTGIVASISNDNL 17
+P TG++ASI++D +
Sbjct: 178 NEPLTGMIASITDDGV 193


tr_hit_id Q75VJ8
Definition tr|Q75VJ8|Q75VJ8_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotiana tabacum
Align length 184
Score (bit) 271.0
E-value 3.0e-71
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920922|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_D08.
(599 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q75VJ8|Q75VJ8_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotia... 271 3e-71
tr|A7NYA8|A7NYA8_VITVI Ubiquitin-activating enzyme E1 OS=Vitis v... 270 5e-71
tr|Q75VJ9|Q75VJ9_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotia... 269 1e-70
tr|Q10MU6|Q10MU6_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 269 1e-70
tr|A3AGY7|A3AGY7_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 266 5e-70
tr|Q84NQ2|Q84NQ2_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 265 1e-69
tr|Q2QYU8|Q2QYU8_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 265 1e-69
tr|Q2RBM4|Q2RBM4_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 264 3e-69
tr|B8BIM9|B8BIM9_ORYSI Putative uncharacterized protein OS=Oryza... 264 3e-69
tr|A9SFQ4|A9SFQ4_PHYPA Ubiquitin-activating enzyme E1 OS=Physcom... 263 4e-69
tr|Q8RX82|Q8RX82_ARATH Ubiquitin-activating enzyme E1 OS=Arabido... 262 1e-68
tr|P93028|P93028_ARATH Ubiquitin-activating enzyme E1 OS=Arabido... 262 1e-68
tr|B8B6A7|B8B6A7_ORYSI Putative uncharacterized protein OS=Oryza... 262 1e-68
tr|P92974|P92974_ARATH Ubiquitin-activating enzyme E1 OS=Arabido... 262 1e-68
tr|A9REZ6|A9REZ6_PHYPA Ubiquitin-activating enzyme E1 OS=Physcom... 262 1e-68
tr|A3CE64|A3CE64_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 255 1e-66
tr|A3BNP3|A3BNP3_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza s... 249 9e-65
tr|A7QKV2|A7QKV2_VITVI Ubiquitin-activating enzyme E1 OS=Vitis v... 241 3e-62
tr|P93393|P93393_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotia... 232 1e-59
tr|B8BNT8|B8BNT8_ORYSI Putative uncharacterized protein OS=Oryza... 221 2e-56
tr|A8J1C1|A8J1C1_CHLRE Ubiquitin-activating enzyme E1 OS=Chlamyd... 194 4e-48
tr|B3RWM5|B3RWM5_TRIAD Putative uncharacterized protein OS=Trich... 182 2e-44
tr|A7SSG6|A7SSG6_NEMVE Ubiquitin-activating enzyme E1 OS=Nematos... 182 2e-44
tr|Q9I943|Q9I943_CARAU Ubiquitin-activating enzyme E1 OS=Carassi... 181 4e-44
tr|Q5JRS0|Q5JRS0_HUMAN Ubiquitin-like modifier activating enzyme... 181 4e-44
tr|Q5JRR9|Q5JRR9_HUMAN Ubiquitin-like modifier activating enzyme... 181 4e-44
tr|Q4RW85|Q4RW85_TETNG Ubiquitin-activating enzyme E1 (Fragment)... 179 1e-43
tr|Q9DEE8|Q9DEE8_XENLA Ubiquitin-activating enzyme E1 OS=Xenopus... 178 2e-43
tr|Q801S7|Q801S7_XENLA Ubiquitin-activating enzyme E1 OS=Xenopus... 178 2e-43
tr|Q6P9P3|Q6P9P3_DANRE Ubiquitin-activating enzyme E1 OS=Danio r... 177 4e-43

>tr|Q75VJ8|Q75VJ8_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotiana
tabacum PE=2 SV=1
Length = 1080

Score = 271 bits (692), Expect = 3e-71
Identities = 131/184 (71%), Positives = 151/184 (82%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
DIDEDLHSRQLAVYGRETMRRLF +NVL+SG+QGLG EIAKN+ILAGVKSV LHD G ++
Sbjct: 72 DIDEDLHSRQLAVYGRETMRRLFASNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGNVE 131

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWDL NF +E DVGKNRALA + KLQELN AV ++ T +T E LS FQAVV T+ +
Sbjct: 132 LWDLSSNFIFTEEDVGKNRALASIQKLQELNNAVIISTLTDALTKEQLSNFQAVVFTDIS 191

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
LE+A +D+YC PP+AFIKA++ GLFGSVFCDFGPEF V DVDGEDPHTGI+ASISN
Sbjct: 192 LEKAVEFDDYCHKHQPPIAFIKAEVRGLFGSVFCDFGPEFTVADVDGEDPHTGIIASISN 251

Query: 25 DNLA 14
DN A
Sbjct: 252 DNPA 255



Score = 40.0 bits (92), Expect = 0.10
Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
Frame = -2

Query: 547 HSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGV-----KSVVLHDTGIMDL 383
+ Q++V+G + ++L A V + G LG E KN+ L GV + + D +++
Sbjct: 475 YDAQISVFGNKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVCCGDKGKLTITDDDVIEK 534

Query: 382 WDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNATL 203
+L F + ++G+ ++ + +N + + + + E S F N ++
Sbjct: 535 SNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIHIEALQNRASPETESVFDDTFWENLSV 594


>tr|A7NYA8|A7NYA8_VITVI Ubiquitin-activating enzyme E1 OS=Vitis
vinifera GN=GSVIVT00024047001 PE=3 SV=1
Length = 1089

Score = 270 bits (690), Expect = 5e-71
Identities = 130/184 (70%), Positives = 153/184 (83%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
DIDEDLHSRQLAVYGRETMRRLF +NVL+SG+QGLG EIAKN+ILAGVKSV LHD G ++
Sbjct: 79 DIDEDLHSRQLAVYGRETMRRLFASNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGTVE 138

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWD+ NF SE DVGKNRALA V KLQELN AV ++ T+++T E LS FQAVV T+
Sbjct: 139 LWDMSSNFIFSENDVGKNRALASVQKLQELNNAVVISTLTTKLTKEDLSDFQAVVFTDIY 198

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
E+A +++YC + PP+AFIKA++ GLFGSVFCDFGPEF VFDVDGE+PHTGI+ASISN
Sbjct: 199 FEKAIEFNDYCHSHQPPIAFIKAEVRGLFGSVFCDFGPEFTVFDVDGEEPHTGIIASISN 258

Query: 25 DNLA 14
DN A
Sbjct: 259 DNPA 262



Score = 43.5 bits (101), Expect = 0.009
Identities = 29/116 (25%), Positives = 57/116 (49%), Gaps = 9/116 (7%)
Frame = -2

Query: 568 MDID-EDLHSR---QLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----S 416
+DID + L+SR Q++V+G + ++L A V + G LG E KN+ L GV
Sbjct: 473 IDIDFKPLNSRYDAQISVFGSKLQKKLEDAVVFMVGSGALGCEFLKNVALMGVSCGNQGK 532

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE 248
+ + D +++ +L F + ++G+ ++ S Q +N + + + + E
Sbjct: 533 LTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAAQTINPCLHIEALQNRVGPE 588


>tr|Q75VJ9|Q75VJ9_TOBAC Ubiquitin-activating enzyme E1 OS=Nicotiana
tabacum PE=2 SV=1
Length = 1080

Score = 269 bits (687), Expect = 1e-70
Identities = 130/184 (70%), Positives = 150/184 (81%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
DIDEDLHSRQLAVYGRETMRRLF +NVL SG+QGLG EIAKN+ILAGVKSV LHD G ++
Sbjct: 72 DIDEDLHSRQLAVYGRETMRRLFASNVLASGLQGLGAEIAKNLILAGVKSVTLHDEGNVE 131

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWDL NF +E DVGKNRALA + KLQELN AV ++ T +T E LS FQAVV T+ +
Sbjct: 132 LWDLSSNFIFTEEDVGKNRALASIQKLQELNNAVIISTLTDALTKEQLSNFQAVVFTDIS 191

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
LE+A +D+YC PP+AFIKA++ GLFGSVFCDFGPEF + DVDGEDPHTGI+ASISN
Sbjct: 192 LEKAVKFDDYCHQHQPPIAFIKAEVRGLFGSVFCDFGPEFTIADVDGEDPHTGIIASISN 251

Query: 25 DNLA 14
DN A
Sbjct: 252 DNPA 255



Score = 39.3 bits (90), Expect = 0.18
Identities = 24/130 (18%), Positives = 56/130 (43%), Gaps = 5/130 (3%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGV-----KSV 413
P+++ + Q++V+G + ++L A + G LG E KN+ L GV +
Sbjct: 465 PNDLKPLNSRYDAQISVFGNKLQKKLEEAKAFVVGSGALGCEFLKNLALMGVCCGDKGKL 524

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGF 233
+ D +++ +L F + ++G+ ++ + +N + + + + E S F
Sbjct: 525 TITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIHIEALQNRASPETESVF 584

Query: 232 QAVVLTNATL 203
N ++
Sbjct: 585 DDTFWENLSV 594


>tr|Q10MU6|Q10MU6_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza
sativa subsp. japonica GN=Os03g0294900 PE=2 SV=1
Length = 1064

Score = 269 bits (687), Expect = 1e-70
Identities = 129/194 (66%), Positives = 159/194 (81%)
Frame = -2

Query: 595 MSSNGSPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKS 416
+S NGS +IDEDLHSRQLAVYGRETMRRLF +NVL+SG+ GLG EIAKN+ LAGVKS
Sbjct: 47 VSGNGS-EVAEIDEDLHSRQLAVYGRETMRRLFASNVLVSGLNGLGAEIAKNLALAGVKS 105

Query: 415 VVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSG 236
+ LHD G +++WDL GNF LSE D+GKNRA+AC +KLQELN AV ++ T ++T E LS
Sbjct: 106 ITLHDMGNVEMWDLSGNFFLSEDDIGKNRAVACTAKLQELNNAVLISTLTEDLTNEHLSK 165

Query: 235 FQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDP 56
FQAVV T+ +L++A +D+YCRN P ++FIKA++ GLFGSVFCDFGP+F V DVDGE+P
Sbjct: 166 FQAVVFTDISLDKAFEFDDYCRNHQPSISFIKAEVCGLFGSVFCDFGPKFTVLDVDGEEP 225

Query: 55 HTGIVASISNDNLA 14
HTGI+ASISNDN A
Sbjct: 226 HTGIIASISNDNPA 239



Score = 44.7 bits (104), Expect = 0.004
Identities = 23/105 (21%), Positives = 51/105 (48%), Gaps = 5/105 (4%)
Frame = -2

Query: 547 HSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SVVLHDTGIMDL 383
+ Q++V+G + +++ ANV + G LG E KN+ L GV + + D I++
Sbjct: 459 YDAQISVFGSKLQKKMRDANVFVVGSGALGCEFLKNLALMGVSCGLKGKLTITDDDIIEK 518

Query: 382 WDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE 248
+L F + ++G+ ++ + +N+++ +N + E
Sbjct: 519 SNLSRQFLFRDWNIGQAKSTVAAAAASAINSSLHINALQNRACPE 563


>tr|A3AGY7|A3AGY7_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza
sativa subsp. japonica GN=OsJ_010059 PE=3 SV=1
Length = 1241

Score = 266 bits (681), Expect = 5e-70
Identities = 125/184 (67%), Positives = 154/184 (83%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
+IDEDLHSRQLAVYGRETMRRLF +NVL+SG+ GLG EIAKN+ LAGVKS+ LHD G ++
Sbjct: 171 EIDEDLHSRQLAVYGRETMRRLFASNVLVSGLNGLGAEIAKNLALAGVKSITLHDMGNVE 230

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
+WDL GNF LSE D+GKNRA+AC +KLQELN AV ++ T ++T E LS FQAVV T+ +
Sbjct: 231 MWDLSGNFFLSEDDIGKNRAVACTAKLQELNNAVLISTLTEDLTNEHLSKFQAVVFTDIS 290

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
L++A +D+YCRN P ++FIKA++ GLFGSVFCDFGP+F V DVDGE+PHTGI+ASISN
Sbjct: 291 LDKAFEFDDYCRNHQPSISFIKAEVCGLFGSVFCDFGPKFTVLDVDGEEPHTGIIASISN 350

Query: 25 DNLA 14
DN A
Sbjct: 351 DNPA 354



Score = 44.7 bits (104), Expect = 0.004
Identities = 23/105 (21%), Positives = 51/105 (48%), Gaps = 5/105 (4%)
Frame = -2

Query: 547 HSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SVVLHDTGIMDL 383
+ Q++V+G + +++ ANV + G LG E KN+ L GV + + D I++
Sbjct: 574 YDAQISVFGSKLQKKMRDANVFVVGSGALGCEFLKNLALMGVSCGLKGKLTITDDDIIEK 633

Query: 382 WDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE 248
+L F + ++G+ ++ + +N+++ +N + E
Sbjct: 634 SNLSRQFLFRDWNIGQAKSTVAAAAASAINSSLHINALQNRACPE 678


>tr|Q84NQ2|Q84NQ2_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza
sativa subsp. japonica GN=P0034A04.123 PE=3 SV=1
Length = 1045

Score = 265 bits (678), Expect = 1e-69
Identities = 130/197 (65%), Positives = 159/197 (80%), Gaps = 3/197 (1%)
Frame = -2

Query: 595 MSSNGSPSEM---DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG 425
++ NGS + + +IDEDLHSRQLAVYGRETMRRLF ++VL+SG+ GLG EIAKN+ LAG
Sbjct: 24 VAQNGSTNGVVVPEIDEDLHSRQLAVYGRETMRRLFASHVLVSGLNGLGAEIAKNLALAG 83

Query: 424 VKSVVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEF 245
VKSV LHD +++WDL NF LSE D+GKNRA ACVSKLQELN AV V+ T E+TT+
Sbjct: 84 VKSVTLHDVKNVEMWDLSANFFLSENDIGKNRAAACVSKLQELNNAVLVSALTEELTTDH 143

Query: 244 LSGFQAVVLTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDG 65
LS FQAVV T+ L++A +D+YC + PP++FIKA++ GLFG+VFCDFGPEF V DVDG
Sbjct: 144 LSKFQAVVFTDIGLDKAYEFDDYCHSHCPPISFIKAEVCGLFGTVFCDFGPEFTVLDVDG 203

Query: 64 EDPHTGIVASISNDNLA 14
EDPHTGI+ASISNDN A
Sbjct: 204 EDPHTGIIASISNDNPA 220



Score = 35.8 bits (81), Expect = 1.9
Identities = 19/96 (19%), Positives = 45/96 (46%), Gaps = 5/96 (5%)
Frame = -2

Query: 547 HSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SVVLHDTGIMDL 383
+ Q++V+G + ++L AN + G LG E KN+ L GV + + D +++
Sbjct: 440 YDAQISVFGSKLQKKLEEANTFVVGSGALGCEFLKNLALMGVSCSPKGKLTITDDDVIEK 499

Query: 382 WDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVN 275
+L F + ++ + ++ + +N + ++
Sbjct: 500 SNLSRQFLFRDWNIRQAKSTVAAAAASAINPNLCID 535


>tr|Q2QYU8|Q2QYU8_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza
sativa subsp. japonica GN=LOC_Os12g01520 PE=3 SV=2
Length = 968

Score = 265 bits (678), Expect = 1e-69
Identities = 127/184 (69%), Positives = 151/184 (82%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
+IDEDLHSRQLAVYGRETM+RLF +NVL+SG+ GLG EIAKN++LAGVKSV LHD ++
Sbjct: 41 EIDEDLHSRQLAVYGRETMKRLFASNVLVSGLNGLGAEIAKNLVLAGVKSVTLHDDDNVE 100

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWDL NF L+E DVG+NRA CV KLQELN AV ++ T ++T E LS FQAVV T+ +
Sbjct: 101 LWDLSSNFFLTEKDVGQNRAQTCVQKLQELNNAVIISTITGDLTKEQLSNFQAVVFTDIS 160

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
LE+A +D+YC N PP+AFIK++I GLFGSVFCDFGPEF V DVDGE+PHTGIVASISN
Sbjct: 161 LEKAVEFDSYCHNHQPPIAFIKSEIRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISN 220

Query: 25 DNLA 14
DN A
Sbjct: 221 DNPA 224



Score = 40.4 bits (93), Expect = 0.079
Identities = 31/149 (20%), Positives = 62/149 (41%), Gaps = 19/149 (12%)
Frame = -2

Query: 574 SEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SVV 410
SE+ + + Q++V+G ++L A + + G LG E KN+ L G+ +
Sbjct: 354 SELKPENTRYDAQISVFGSNLQKKLEQAKIFMVGSGALGCEFLKNLALMGISCNQNGKLT 413

Query: 409 LHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE------ 248
+ D +++ +L F + ++G+ ++ + +N + V + + E
Sbjct: 414 VTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMAINPKLHVEALQNRASPETENVFN 473

Query: 247 --FLSGFQAVV--LTNAT----LEQACTY 185
F AVV L N T ++ C Y
Sbjct: 474 DAFWESLDAVVNALDNVTARMYIDSRCVY 502


>tr|Q2RBM4|Q2RBM4_ORYSJ Ubiquitin-activating enzyme E1 OS=Oryza
sativa subsp. japonica GN=Os11g0106400 PE=3 SV=1
Length = 1048

Score = 264 bits (675), Expect = 3e-69
Identities = 127/184 (69%), Positives = 151/184 (82%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
+IDEDLHSRQLAVYGRETM+RLF +NVL+SG+ GLG EIAKN++LAGVKSV LHD ++
Sbjct: 40 EIDEDLHSRQLAVYGRETMKRLFASNVLVSGLNGLGAEIAKNLVLAGVKSVNLHDDDNVE 99

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWDL NF L+E DVG+NRA CV KLQELN AV ++ T ++T E LS FQAVV T+ +
Sbjct: 100 LWDLSSNFFLTEKDVGQNRAQTCVQKLQELNNAVIISTITGDLTKEQLSNFQAVVFTDIS 159

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
LE+A +D+YC N PP+AFIK++I GLFGSVFCDFGPEF V DVDGE+PHTGIVASISN
Sbjct: 160 LEKAVEFDSYCHNHQPPIAFIKSEIRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISN 219

Query: 25 DNLA 14
DN A
Sbjct: 220 DNPA 223



Score = 43.1 bits (100), Expect = 0.012
Identities = 31/150 (20%), Positives = 64/150 (42%), Gaps = 19/150 (12%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SV 413
P+E+ + + Q++V+G ++L A + + G LG E KN+ L G+ +
Sbjct: 433 PAELKPENTRYDAQISVFGSNLQKKLEQAKIFMVGSGALGCEFLKNLALMGISCNQNGKL 492

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE----- 248
++ D +++ +L F + ++G+ ++ + +N + V + + E
Sbjct: 493 IVTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMAINPKLHVEALQNRASPETENVF 552

Query: 247 ---FLSGFQAVV--LTNAT----LEQACTY 185
F AVV L N T ++ C Y
Sbjct: 553 NDAFWESLDAVVNALDNVTARMYIDSRCVY 582


>tr|B8BIM9|B8BIM9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34806 PE=4 SV=1
Length = 1099

Score = 264 bits (675), Expect = 3e-69
Identities = 127/184 (69%), Positives = 151/184 (82%)
Frame = -2

Query: 565 DIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHDTGIMD 386
+IDEDLHSRQLAVYGRETM+RLF +NVL+SG+ GLG EIAKN++LAGVKSV LHD ++
Sbjct: 102 EIDEDLHSRQLAVYGRETMKRLFASNVLVSGLNGLGAEIAKNLVLAGVKSVNLHDDDNVE 161

Query: 385 LWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVVLTNAT 206
LWDL NF L+E DVG+NRA CV KLQELN AV ++ T ++T E LS FQAVV T+ +
Sbjct: 162 LWDLSSNFFLTEKDVGQNRAQTCVQKLQELNNAVIISTITGDLTKEQLSNFQAVVFTDIS 221

Query: 205 LEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIVASISN 26
LE+A +D+YC N PP+AFIK++I GLFGSVFCDFGPEF V DVDGE+PHTGIVASISN
Sbjct: 222 LEKAVEFDSYCHNHQPPIAFIKSEIRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISN 281

Query: 25 DNLA 14
DN A
Sbjct: 282 DNPA 285



Score = 43.1 bits (100), Expect = 0.012
Identities = 31/150 (20%), Positives = 64/150 (42%), Gaps = 19/150 (12%)
Frame = -2

Query: 577 PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK-----SV 413
P+E+ + + Q++V+G ++L A + + G LG E KN+ L G+ +
Sbjct: 495 PAELKPENTRYDAQISVFGSNLQKKLEQAKIFMVGSGALGCEFLKNLALMGISCNQNGKL 554

Query: 412 VLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTE----- 248
++ D +++ +L F + ++G+ ++ + +N + V + + E
Sbjct: 555 IVTDDDVIEKSNLSRQFLFRDWNIGQPKSTVAATAAMAINPKLHVEALQNRASPETENVF 614

Query: 247 ---FLSGFQAVV--LTNAT----LEQACTY 185
F AVV L N T ++ C Y
Sbjct: 615 NDAFWESLDAVVNALDNVTARMYIDSRCVY 644


>tr|A9SFQ4|A9SFQ4_PHYPA Ubiquitin-activating enzyme E1
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_129081 PE=3 SV=1
Length = 1018

Score = 263 bits (673), Expect = 4e-69
Identities = 130/189 (68%), Positives = 149/189 (78%)
Frame = -2

Query: 580 SPSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVKSVVLHD 401
S E++IDEDLHSRQLAVYGRETMRRLFGA VLISG+QGLGVEIAKN+ILAGVKSV LHD
Sbjct: 5 SNMEVEIDEDLHSRQLAVYGRETMRRLFGAQVLISGLQGLGVEIAKNVILAGVKSVTLHD 64

Query: 400 TGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELNTAVSVNVYTSEITTEFLSGFQAVV 221
G ++LWDL F +E DVGKNRALAC KL+ELNTAV V T +IT + LS VV
Sbjct: 65 AGNVELWDLSAQFYFTEEDVGKNRALACADKLKELNTAVLVTTSTGDITEQLLSAHSVVV 124

Query: 220 LTNATLEQACTYDNYCRNQTPPVAFIKADIHGLFGSVFCDFGPEFKVFDVDGEDPHTGIV 41
T+ TL++A D +C + P +AFIKADI G+FGSVFCDFGP F V DVDGE+PHTGI+
Sbjct: 125 FTDITLDKAIEIDEFCHRREPAIAFIKADIRGVFGSVFCDFGPSFTVVDVDGEEPHTGII 184

Query: 40 ASISNDNLA 14
ASISNDN A
Sbjct: 185 ASISNDNPA 193



Score = 36.2 bits (82), Expect = 1.5
Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 11/106 (10%)
Frame = -2

Query: 577 PSEMDIDED---LHSR---QLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAGVK- 419
P+E ED L+SR Q+AV+G + ++L + + + G LG E KN+ L GV
Sbjct: 398 PAEPLTPEDVKPLNSRYDAQIAVFGSKVQQKLEQSKLFLVGAGALGCEFLKNLALMGVSC 457

Query: 418 ----SVVLHDTGIMDLWDLGGNFCLSEADVGKNRALACVSKLQELN 293
++ + D +++ +L F + ++G+ ++ S +N
Sbjct: 458 GPKGNLTVTDDDVIEKSNLSRQFLFRDWNIGQAKSTVASSAAIAIN 503