BP920927
Clone id YMU001_000143_E02
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000143_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGAACCAAGGTGTCCAGTATCATGAGTATTTCTTTTGCCTTATTAGCTTCCATGCTAG
GGTCATCCAATGCTCTCTTCGGTTGATTGTTTCGATCTACAAGAACAACGGGCTCTTCTA
CTCTAGCATTGTTCTCCCTCTCTTGCGTACATACATTTCCATCGTTATTAAACTCAAAAT
TGGGCATGGCTCTTTCCAATAATTCATTGTTCTTCCTCCCTTGCCTACATCCATTTCCAT
CATTATTAGATTCAAAATTGGGCATGGCTCTTTTCAATAATTCATGTCTTGCATTGTCCA
TTCTTCCTGATGGTAGGTTCCCACATGCTTCGGACCACCTTCCCTTAGGTACATGGTCTT
TCTCAGCAAGACCAATGTTCTGATCTTGAGGGGCCGATAAAGCCTCCTTGGTAAAACCCA
CATCATTGCATTCCAGTGGCTCTGTGTGCCCATCTGACATTAAATTGATATCACCTTCAT
TACCACAAGCTTCATGTCCGTTAAGGGTGAGATTCACAGTAGTGGGCTCTGTCTTTTTAT
C
■■Homology search results ■■ -
sp_hit_id Q54S94
Definition sp|Q54S94|FAM50_DICDI Protein FAM50 homolog OS=Dictyostelium discoideum
Align length 89
Score (bit) 37.0
E-value 0.058
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920927|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_E02.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54S94|FAM50_DICDI Protein FAM50 homolog OS=Dictyostelium dis... 37 0.058
sp|Q9Y800|MUG97_SCHPO Meiotically up-regulated gene 97 protein O... 34 0.38
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Di... 34 0.49
sp|Q550D5|GTAA_DICDI Transcription factor stalky OS=Dictyosteliu... 34 0.49
sp|Q54PK8|Y4491_DICDI Probable serine/threonine-protein kinase D... 32 1.9
sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase if... 32 1.9
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase D... 32 2.4
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dic... 32 2.4
sp|Q54X86|STX7B_DICDI Probable syntaxin-7B OS=Dictyostelium disc... 31 3.2
sp|Q54NC8|INT1_DICDI Integrator complex subunit 1 homolog OS=Dic... 31 3.2
sp|Q54P94|Y6147_DICDI Putative uncharacterized protein DDB_G0284... 31 4.1
sp|Q6B516|SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium disc... 31 4.1
sp|Q8K2W9|CN093_MOUSE Uncharacterized protein C14orf93 homolog O... 31 4.1
sp|Q118K5|CCS1_TRIEI Cytochrome c biogenesis protein ccsB OS=Tri... 31 4.1
sp|B1WRN9|CCS1_CYAA5 Cytochrome c biogenesis protein ccsB OS=Cya... 31 4.1
sp|Q8I3Z1|MLRR1_PLAF7 MATH and LRR domain-containing protein PFE... 30 5.4
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium... 30 5.4
sp|Q54B64|Y2175_DICDI Putative uncharacterized protein DDB_G0293... 30 7.1
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi... 30 7.1
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=D... 30 7.1
sp|P53267|DAM1_YEAST DASH complex subunit DAM1 OS=Saccharomyces ... 30 7.1
sp|Q8WT51|YL4M_CAEEL Uncharacterized protein F35H12.5 OS=Caenorh... 30 9.2
sp|Q54B48|Y3958_DICDI Probable serine/threonine-protein kinase D... 30 9.2
sp|Q54FS1|Y0639_DICDI FNIP repeat-containing protein DDB_G029063... 30 9.2
sp|A8FJP1|UNG_CAMJ8 Uracil-DNA glycosylase OS=Campylobacter jeju... 30 9.2
sp|Q54QM6|MPIP_DICDI M-phase inducer phosphatase OS=Dictyosteliu... 30 9.2
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-depe... 30 9.2
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase... 30 9.2
sp|P43573|BUD27_YEAST Bud site selection protein 27 OS=Saccharom... 30 9.2

>sp|Q54S94|FAM50_DICDI Protein FAM50 homolog OS=Dictyostelium
discoideum GN=fam50 PE=3 SV=1
Length = 362

Score = 37.0 bits (84), Expect = 0.058
Identities = 25/89 (28%), Positives = 47/89 (52%)
Frame = -2

Query: 295 NARHELLKRAMPNFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENNARVE 116
N + ++ +++ +FE ++DG+G + +NNE N E NN+ N +E +N+ +
Sbjct: 108 NKKLKITQKSKLSFELDDDGDGDGENNENNE-------NNEENNENN---EENKNDKEND 157

Query: 115 EPVVLVDRNNQPKRALDDPSMEANKAKEI 29
E V + NN+ K DPS+ + +I
Sbjct: 158 EDNVNNNNNNKIKYFGKDPSVNTDFLPDI 186


>sp|Q9Y800|MUG97_SCHPO Meiotically up-regulated gene 97 protein
OS=Schizosaccharomyces pombe GN=mug97 PE=1 SV=1
Length = 335

Score = 34.3 bits (77), Expect = 0.38
Identities = 15/33 (45%), Positives = 19/33 (57%)
Frame = -2

Query: 442 EPLECNDVGFTKEALSAPQDQNIGLAEKDHVPK 344
+PL+ N GFTK L P +N+ E HVPK
Sbjct: 22 QPLQINQFGFTKTQLHKPLTRNLSNKEDTHVPK 54


>sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685
OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2
Length = 1081

Score = 33.9 bits (76), Expect = 0.49
Identities = 20/57 (35%), Positives = 28/57 (49%)
Frame = -2

Query: 253 ESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENNARVEEPVVLVDRNNQ 83
E N DG QG +NN+ ++ + E N DG+ Q+ ENN E + NNQ
Sbjct: 764 EDNQDGGENNQGDENNQDVDENNQDGENNQDGDENNQDGENNQDGENNQDGDENNNQ 820



Score = 30.4 bits (67), Expect = 5.4
Identities = 29/100 (29%), Positives = 42/100 (42%)
Frame = -2

Query: 382 QNIGLAEKDHVPKGRWSEACGNLPSGRMDNARHELLKRAMPNFESNNDGNGCRQGRKNNE 203
Q++G+ K PK + N + +N + + N + NN G QG +NN+
Sbjct: 379 QSVGIIPKKQEPK---KDENNNQSNNNNNNNQAGDDQNKNQNRDENNQGGENNQGGENNQ 435

Query: 202 LLERAMPNFEFNNDGNVCTQERENNARVEEPVVLVDRNNQ 83
E N + NN G Q ENN E D+NNQ
Sbjct: 436 DGENNQ-NGDENNQGGENNQGDENNQGGENN--QGDQNNQ 472


>sp|Q550D5|GTAA_DICDI Transcription factor stalky OS=Dictyostelium
discoideum GN=stkA PE=1 SV=1
Length = 872

Score = 33.9 bits (76), Expect = 0.49
Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 7/69 (10%)
Frame = -2

Query: 271 RAMPNFESNNDGNGCRQGRKN-------NELLERAMPNFEFNNDGNVCTQERENNARVEE 113
R PN +NN+ N + N N LE + N NN+ N NN +
Sbjct: 56 RQQPNSNTNNNSNNKNNNKSNLLDIILDNNNLENNIDNNNNNNNNNNNNNNNNNNNNSKS 115

Query: 112 PVVLVDRNN 86
+ L+D NN
Sbjct: 116 IINLIDNNN 124


>sp|Q54PK8|Y4491_DICDI Probable serine/threonine-protein kinase
DDB_G0284491 OS=Dictyostelium discoideum GN=DDB_G0284491
PE=3 SV=1
Length = 1212

Score = 32.0 bits (71), Expect = 1.9
Identities = 14/55 (25%), Positives = 24/55 (43%)
Frame = -2

Query: 250 SNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENNARVEEPVVLVDRNN 86
+NN+ N NN L N FNND N+ + N+ + +++ N+
Sbjct: 289 NNNNDNNLNNNNSNNNLNNNNNSNSNFNNDNNLNSNINSNDTSISNNNSIINNNS 343


>sp|Q558U1|IFKA_DICDI Probable serine/threonine-protein kinase ifkA
OS=Dictyostelium discoideum GN=ifkA PE=2 SV=1
Length = 2258

Score = 32.0 bits (71), Expect = 1.9
Identities = 23/84 (27%), Positives = 34/84 (40%)
Frame = -2

Query: 259 NFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENNARVEEPVVLVDRNNQP 80
N +NN+ N NN N NN+ N NN + ++ NN
Sbjct: 233 NNNNNNNTNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNISNNKINKINNNNNN 292

Query: 79 KRALDDPSMEANKAKEILMILDTL 8
K +D+ + NK KE +I DT+
Sbjct: 293 KELIDNNN--NNKDKENDLINDTI 314


>sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase
DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282
PE=3 SV=1
Length = 2102

Score = 31.6 bits (70), Expect = 2.4
Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 1/76 (1%)
Frame = -2

Query: 259 NFESNNDGNGCRQGRKNNELLERAMPNFEFN-NDGNVCTQERENNARVEEPVVLVDRNNQ 83
N +NN+ N NN E N E N ND N NN + L+ N+
Sbjct: 717 NNNNNNNNNNNNNNNNNNNTTELVNNNIESNDNDNNNSNNNNNNNNNSNNSLDLI---NK 773

Query: 82 PKRALDDPSMEANKAK 35
P + +P + K+K
Sbjct: 774 PLVKIIEPKKKEKKSK 789


>sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1
OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1
Length = 2269

Score = 31.6 bits (70), Expect = 2.4
Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%)
Frame = -2

Query: 250 SNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQE----RENNARVEEPVVLVD 95
SNN NG Q +K+N +LE + PN + G + + NN ++ + + D
Sbjct: 1575 SNNGNNGSSQFKKSNTILESSKPNIDLTAPGAIIALSLIYLKTNNLKISNYLSIPD 1630


>sp|Q54X86|STX7B_DICDI Probable syntaxin-7B OS=Dictyostelium
discoideum GN=syn7B PE=3 SV=1
Length = 286

Score = 31.2 bits (69), Expect = 3.2
Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 4/88 (4%)
Frame = -2

Query: 259 NFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENNARVEEPV---VLVDRN 89
N SNN+G R G + ++ N NN+ N E E R+E+ + + D
Sbjct: 122 NGNSNNNGYNTRGGYNQQQQQQQQQYNDYTNNNNNNNNNEVEQYNRLEQALKSGIEQDEE 181

Query: 88 NQPKRALDDPSMEANK-AKEILMILDTL 8
R LD+ + A + A+++ M+ + +
Sbjct: 182 EYTNRILDERNANARQIARDVAMLKEAM 209


>sp|Q54NC8|INT1_DICDI Integrator complex subunit 1 homolog
OS=Dictyostelium discoideum GN=ints1 PE=3 SV=1
Length = 2497

Score = 31.2 bits (69), Expect = 3.2
Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 14/99 (14%)
Frame = -2

Query: 259 NFESNNDGNGCRQGRKNNELLERAMPNFEFNND----------GNVCTQERENNARVEEP 110
N ++NN+ N NN N NND N+ +NN + ++
Sbjct: 1236 NNDNNNNNNNNNNNNNNNNNNNNNDNNINKNNDDNNHSNSMANNNLPNNNNKNNQKSKKW 1295

Query: 109 VVLVDRNNQPKRALDDPSMEANKAKEIL----MILDTLV 5
V ++ +N DD SME + ++I+ ++LD+++
Sbjct: 1296 VKIIKNSNNKNN--DDNSMEDDNNEDIIYLPRIVLDSII 1332


tr_hit_id B6MRB8
Definition tr|B6MRB8|B6MRB8_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 81
Score (bit) 38.9
E-value 0.16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920927|Adiantum capillus-veneris mRNA, clone:
YMU001_000143_E02.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6MRB8|B6MRB8_BRAFL Putative uncharacterized protein OS=Branc... 39 0.16
tr|B4QUB8|B4QUB8_DROSI GD18233 OS=Drosophila simulans GN=GD18233... 37 0.61
tr|B3L6L5|B3L6L5_PLAKH DNA repair protein, putative OS=Plasmodiu... 37 0.80
tr|A7TMC0|A7TMC0_VANPO Putative uncharacterized protein OS=Vande... 37 0.80
tr|Q8IBL6|Q8IBL6_PLAF7 Putative uncharacterized protein PF07_010... 34 4.0
tr|Q4XQR2|Q4XQR2_PLACH Putative uncharacterized protein (Fragmen... 34 4.0
tr|B4KMC6|B4KMC6_DROMO GI18846 OS=Drosophila mojavensis GN=GI188... 34 4.0
tr|B1FSN8|B1FSN8_9BURK Sensor protein OS=Burkholderia graminis C... 34 5.2
tr|Q7RKF6|Q7RKF6_PLAYO Chloroquine resistance marker protein, pu... 34 5.2
tr|Q4XCU5|Q4XCU5_PLACH Putative uncharacterized protein (Fragmen... 34 5.2
tr|A5K648|A5K648_PLAVI CW-type zinc finger domain-containing pro... 34 5.2
tr|A0YXW6|A0YXW6_9CYAN ResB-like protein OS=Lyngbya sp. PCC 8106... 33 6.7
tr|Q0JJF7|Q0JJF7_ORYSJ Os01g0741800 protein OS=Oryza sativa subs... 33 6.7
tr|Q8III2|Q8III2_PLAF7 Putative uncharacterized protein OS=Plasm... 33 6.7
tr|Q55AJ7|Q55AJ7_DICDI Putative uncharacterized protein OS=Dicty... 33 6.7
tr|Q4YNW3|Q4YNW3_PLABE Putative uncharacterized protein (Fragmen... 33 6.7
tr|A8X9A9|A8X9A9_CAEBR CBR-HEX-2 protein OS=Caenorhabditis brigg... 33 6.7
tr|A4HJW9|A4HJW9_LEIBR Putative uncharacterized protein OS=Leish... 33 6.7
tr|B8MQE5|B8MQE5_9EURO Zinc/cadmium resistance protein OS=Talaro... 33 6.7
tr|B8MQE4|B8MQE4_9EURO Zinc/cadmium resistance protein OS=Talaro... 33 6.7
tr|A1SYI9|A1SYI9_PSYIN Hemagglutinin/hemolysin-related protein O... 33 8.8
tr|Q4HMU5|Q4HMU5_CAMLA Highly acidic protein Cj1178c OS=Campylob... 33 8.8
tr|Q8IHZ5|Q8IHZ5_PLAF7 Subtilisin-like protease 2 OS=Plasmodium ... 33 8.8
tr|Q86I37|Q86I37_DICDI Putative uncharacterized protein OS=Dicty... 33 8.8
tr|Q7RM61|Q7RM61_PLAYO HORMA domain, putative OS=Plasmodium yoel... 33 8.8
tr|Q7RA10|Q7RA10_PLAYO TERT gene (Fragment) OS=Plasmodium yoelii... 33 8.8
tr|Q75J95|Q75J95_DICDI Putative uncharacterized protein OS=Dicty... 33 8.8
tr|Q55GN1|Q55GN1_DICDI Putative uncharacterized protein OS=Dicty... 33 8.8
tr|Q55FL1|Q55FL1_DICDI Zinc/iron permease OS=Dictyostelium disco... 33 8.8
tr|Q54P60|Q54P60_DICDI Glycosyltransferase OS=Dictyostelium disc... 33 8.8

>tr|B6MRB8|B6MRB8_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_85703 PE=4 SV=1
Length = 1256

Score = 38.9 bits (89), Expect = 0.16
Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 9/81 (11%)
Frame = -2

Query: 250 SNNDGNGCRQGRKNNELLERAMPNFEFNNDGN--VCTQERENNARVEEP-------VVLV 98
+NNDGN C Q N E NNDGN V Q+ E EP V+V
Sbjct: 14 NNNDGNPCTQPSANARQPEDEATFMPANNDGNQPVTQQKNEEEENAIEPETLHTSSPVVV 73

Query: 97 DRNNQPKRALDDPSMEANKAK 35
D +N K + D P++ +++++
Sbjct: 74 DASNTTKPSSDHPTVVSSRSR 94


>tr|B4QUB8|B4QUB8_DROSI GD18233 OS=Drosophila simulans GN=GD18233
PE=4 SV=1
Length = 1159

Score = 37.0 bits (84), Expect = 0.61
Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 10/124 (8%)
Frame = -2

Query: 385 DQNI--GLAEKDHVPKGRWSEACG--NLPSGRMDNARHELLKRAMPNFESNNDGNGCRQG 218
DQN+ L+ K H+ + E P+G E K+ P +NN+ N
Sbjct: 66 DQNLFSHLSGKKHIAAMKLQEQLQIRTKPNGAPQKLVTEPTKKG-PITNANNNKNSPSPV 124

Query: 217 RKNNELLERAMPNFEFNNDGNVCTQERENN------ARVEEPVVLVDRNNQPKRALDDPS 56
KN+ ++++ +PN N + NV Q EN + ++PV+ V + P + +++P+
Sbjct: 125 VKNSPIIKKNVPNQNSNANTNVVNQAAENEVAKTQPTQNKKPVIGVKTQSTPPKVVNNPN 184

Query: 55 MEAN 44
+ N
Sbjct: 185 TQKN 188


>tr|B3L6L5|B3L6L5_PLAKH DNA repair protein, putative OS=Plasmodium
knowlesi (strain H) GN=PKH_102750 PE=4 SV=1
Length = 1303

Score = 36.6 bits (83), Expect = 0.80
Identities = 19/49 (38%), Positives = 29/49 (59%)
Frame = -2

Query: 343 GRWSEACGNLPSGRMDNARHELLKRAMPNFESNNDGNGCRQGRKNNELL 197
GR +++ GN P ++N H ++ MPNF SNN GC+Q ++ LL
Sbjct: 1027 GRSADSHGNEPFLILENNIHPVVATLMPNFISNNIYMGCKQENQSTLLL 1075


>tr|A7TMC0|A7TMC0_VANPO Putative uncharacterized protein
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=Kpol_520p37 PE=4 SV=1
Length = 396

Score = 36.6 bits (83), Expect = 0.80
Identities = 25/94 (26%), Positives = 48/94 (51%)
Frame = -2

Query: 307 GRMDNARHELLKRAMPNFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENN 128
G MDN + ++ M + E +ND N +G ++E E +DGN+ ++E+++
Sbjct: 288 GEMDNEMNNEIEDEMADMELDNDINEDPEGDMDDEDEEHE------EHDGNITSEEQDDE 341

Query: 127 ARVEEPVVLVDRNNQPKRALDDPSMEANKAKEIL 26
A EE +D + + +D+P+ E + + E L
Sbjct: 342 ALSEEH---LDDEHVSEEPMDEPTPEGSGSPEEL 372


>tr|Q8IBL6|Q8IBL6_PLAF7 Putative uncharacterized protein PF07_0100
OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0100 PE=4
SV=1
Length = 1032

Score = 34.3 bits (77), Expect = 4.0
Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 2/96 (2%)
Frame = -2

Query: 475 GDINLMSDGHTEPLECNDVGFTKEALSAPQDQNIGLAEKDHVPKGRWSEACGNLPSGRMD 296
G+ + DG E N G KE + + +NIG EK+HV CG+ + D
Sbjct: 789 GEKENIGDGEKE----NIGGGEKENIGDGEKENIGGDEKEHVGGDEKEHTCGDNQASPCD 844

Query: 295 NARHELLKRAMPNFESNNDGNGC--RQGRKNNELLE 194
+ H + A N +D + C + N+EL++
Sbjct: 845 HRNHCDGEEAHENTTYKSDKSNCLFEKNTNNDELMK 880


>tr|Q4XQR2|Q4XQR2_PLACH Putative uncharacterized protein (Fragment)
OS=Plasmodium chabaudi GN=PC000212.04.0 PE=3 SV=1
Length = 503

Score = 34.3 bits (77), Expect = 4.0
Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%)
Frame = -2

Query: 298 DNARHELLKRAMPNFESNNDGNGCRQGRKNNELLERAMPNFEFNNDG-NVCTQERENNAR 122
DN +HE + S GN ++ NN+L++ P F N D ++C + N
Sbjct: 158 DNTKHE-------DIPSKTSGNEYKEVENNNDLIDLKAPQFYTNKDSTSICNDDNAENVL 210

Query: 121 VEEPVVLVDRNNQPKRALDD 62
++ V +N+ LDD
Sbjct: 211 ADDTNVCEKKNDN----LDD 226


>tr|B4KMC6|B4KMC6_DROMO GI18846 OS=Drosophila mojavensis GN=GI18846
PE=4 SV=1
Length = 1465

Score = 34.3 bits (77), Expect = 4.0
Identities = 33/138 (23%), Positives = 54/138 (39%), Gaps = 8/138 (5%)
Frame = -2

Query: 445 TEPLECNDVGFTKEALSAPQDQNIGLAEKDHVPKGRWSEACGNLPSGRMDNARHELLKRA 266
+EP EC +VG K A +D+++GL + + N H LK +
Sbjct: 1120 SEPTECINVGTQKTAEKMRKDEDLGL--------------MATISAVLYANTEHANLKES 1165

Query: 265 MPNFESNNDGNGCRQGRKNNELL--ERAMPNFEFNNDGNVCTQERENNARVEEPVVLVDR 92
PN+ C+Q K L E+ P + D ++R +V +P L +
Sbjct: 1166 YPNWTDR-----CKQILKRWRSLCNEKKAPFLQKAKDNRSALRQRREQCKVTQPPKLEKQ 1220

Query: 91 N------NQPKRALDDPS 56
+ NQP + +D S
Sbjct: 1221 DDGRAWKNQPCKPKEDQS 1238


>tr|B1FSN8|B1FSN8_9BURK Sensor protein OS=Burkholderia graminis
C4D1M GN=BgramDRAFT_0160 PE=3 SV=1
Length = 474

Score = 33.9 bits (76), Expect = 5.2
Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 1/63 (1%)
Frame = -2

Query: 304 RMDNARHELLKRAMP-NFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERENN 128
R NA H R + + S DG R GR +L A+ FE N GN+ Q RE +
Sbjct: 32 RAMNAAHAAFDRTLEFSLRSIRDGVRLRDGRIEVDLPYLALEMFESNGGGNIYYQIREEH 91

Query: 127 ARV 119
RV
Sbjct: 92 GRV 94


>tr|Q7RKF6|Q7RKF6_PLAYO Chloroquine resistance marker protein,
putative OS=Plasmodium yoelii yoelii GN=PY02945 PE=4 SV=1
Length = 6636

Score = 33.9 bits (76), Expect = 5.2
Identities = 17/49 (34%), Positives = 24/49 (48%)
Frame = -2

Query: 283 ELLKRAMPNFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQER 137
E ++ + NNDGNG R G N + + NF F ND ++ ER
Sbjct: 3230 EYSEKEKDKYLGNNDGNGERMGIFNKSKFLKNIENFNFENDEDMHVYER 3278


>tr|Q4XCU5|Q4XCU5_PLACH Putative uncharacterized protein (Fragment)
OS=Plasmodium chabaudi GN=PC403263.00.0 PE=4 SV=1
Length = 203

Score = 33.9 bits (76), Expect = 5.2
Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
Frame = -2

Query: 310 SGRMDNA-RHELLKRAMPNFESNNDGNGCRQGRKNNELLERAMPNFEFNNDGNVCTQERE 134
S RM++A +L R +PN +N+D N C G N+ ++ER PN +N G+ T
Sbjct: 2 SNRMNSAIADNILMRILPN--NNSDNNNCINGY-NSRIMERDDPNKSIDNKGDHSTCSNG 58

Query: 133 N 131
N
Sbjct: 59 N 59