BP920986
Clone id YMU001_000144_B10
Library
Length 376
Definition Adiantum capillus-veneris PHOT2 mRNA for phototropin 2, partial cds
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACCTTGCTGTTTCCTCACTGAACACCTTTCGTGGTTGCCTGTCAAGCAGCAAGAAAAGC
TCCCCACCAGGACAAAAGTCCGTTACTAGGCAAACATGAGTTTGTGTTTGGAAGGAGGCA
TATAGAGCTGGCAGAAAAGGGTGATCCAAAACAGCTAGAATCTCTCTTTCTGCACAAGCA
CGGTGTACCTTGTTGCGGTTCAACATGACGCTTTTCTCCATAGCTTTGATAGCAAAAAGC
TCACCTGAACCACGCAATTCAACAAGATGCACACTTCCCGTGTCCCCAAATCCAAGCGGC
TTTACAGGTCGAAAATGTTTCAGACCAATCTTTTCTCCTCTTTCACGAATCTTTTGAAGA
GCCTTCCACAGATCAC
■■Homology search results ■■ -
sp_hit_id P93025
Definition sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana
Align length 122
Score (bit) 203.0
E-value 2.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920986|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_B10.
(376 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=P... 203 2e-52
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=P... 197 1e-50
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris... 131 9e-31
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. ... 125 8e-29
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. ... 124 1e-28
sp|Q05999|KPK7_ARATH Putative serine/threonine-protein kinase PK... 122 4e-28
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Ne... 103 2e-22
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=S... 94 3e-19
sp|P25341|KIN82_YEAST Probable serine/threonine-protein kinase K... 92 8e-19
sp|P53739|KN8R_YEAST Probable serine/threonine-protein kinase YN... 89 5e-18
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=S... 87 3e-17
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Klu... 83 4e-16
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Deb... 83 4e-16
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo ... 82 6e-16
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ash... 81 1e-15
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Sac... 80 2e-15
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase D... 80 3e-15
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pne... 80 4e-15
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Can... 80 4e-15
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase O... 79 7e-15
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus m... 79 9e-15
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 muri... 78 1e-14
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=... 78 1e-14
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase O... 78 1e-14
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase O... 78 1e-14
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase O... 78 2e-14
sp|Q2LZZ7|ST38L_DROPS Serine/threonine-protein kinase 38-like OS... 77 2e-14
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo ... 77 2e-14
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic sub... 77 3e-14
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS... 77 3e-14

>sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana
GN=PHOT2 PE=1 SV=2
Length = 915

Score = 203 bits (517), Expect = 2e-52
Identities = 90/122 (73%), Positives = 110/122 (90%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
WKA++KI+ GE +GL HF+P+KPLG GDTGSVHLVEL+G+GEL+A+KAMEK++MLNRNK
Sbjct: 559 WKAIKKIQASGETVGLHHFKPIKPLGSGDTGSVHLVELKGTGELYAMKAMEKTMMLNRNK 618

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
HRAC EREI+++LDHPFLP LYASFQT THVCL+TDFCPGGELF LLDRQP K+ +E++
Sbjct: 619 AHRACIEREIISLLDHPFLPTLYASFQTSTHVCLITDFCPGGELFALLDRQPMKILTEDS 678

Query: 8 AR 3
AR
Sbjct: 679 AR 680


>sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1
PE=1 SV=1
Length = 996

Score = 197 bits (501), Expect = 1e-50
Identities = 93/122 (76%), Positives = 108/122 (88%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A+QK+ E GE IGLKHF+PVKPLG GDTGSVHLVEL G+ +LFA+KAM+K+VMLNRNK
Sbjct: 645 WIAIQKVLESGEPIGLKHFKPVKPLGSGDTGSVHLVELVGTDQLFAMKAMDKAVMLNRNK 704

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRA AEREIL +LDHPFLPALYASFQT+TH+CL+TD+ PGGELF+LLDRQPRKV E+
Sbjct: 705 VHRARAEREILDLLDHPFLPALYASFQTKTHICLITDYYPGGELFMLLDRQPRKVLKEDA 764

Query: 8 AR 3
R
Sbjct: 765 VR 766


>sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris
PE=2 SV=1
Length = 609

Score = 131 bits (330), Expect = 9e-31
Identities = 64/122 (52%), Positives = 81/122 (66%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W+A+Q +R R + ++HFR +K LG GD GSV+L EL G+ FA+K M K+ + NR K
Sbjct: 211 WEAIQAVRTRDGMLEMRHFRLLKKLGCGDIGSVYLAELSGTRTSFAMKVMNKTELANRKK 270

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
+ RA EREIL LDHPFLP LY F+T+ CLV +FCPGG+L L RQP K FSE
Sbjct: 271 LLRAQTEREILQSLDHPFLPTLYTHFETEIFSCLVMEFCPGGDLHALRQRQPGKYFSEHA 330

Query: 8 AR 3
R
Sbjct: 331 VR 332


>sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp.
indica GN=OsI_021818 PE=2 SV=1
Length = 589

Score = 125 bits (313), Expect = 8e-29
Identities = 61/122 (50%), Positives = 80/122 (65%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W+A+Q IR R +GL HF+ +K LG GD GSV+L EL G+ FA+K M+K+ + +R K
Sbjct: 177 WEAIQMIRTRDGILGLSHFKLLKKLGCGDIGSVYLSELNGTKSYFAMKVMDKASLASRKK 236

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
+ RA E+EIL LDHPFLP LY F+T CLV +FCPGG+L L RQ K F E+
Sbjct: 237 LLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLRQRQRGKYFPEQA 296

Query: 8 AR 3
+
Sbjct: 297 VK 298


>sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp.
japonica GN=Os06g0291600 PE=2 SV=1
Length = 589

Score = 124 bits (312), Expect = 1e-28
Identities = 61/122 (50%), Positives = 80/122 (65%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W+A+Q IR R +GL HF+ +K LG GD GSV+L EL G+ FA+K M+K+ + +R K
Sbjct: 177 WEAIQMIRTRDGILGLSHFKLLKKLGCGDIGSVYLSELSGTKSYFAMKVMDKASLASRKK 236

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
+ RA E+EIL LDHPFLP LY F+T CLV +FCPGG+L L RQ K F E+
Sbjct: 237 LLRAQTEKEILQCLDHPFLPTLYTHFETDKFSCLVMEFCPGGDLHTLRQRQRGKYFPEQA 296

Query: 8 AR 3
+
Sbjct: 297 VK 298


>sp|Q05999|KPK7_ARATH Putative serine/threonine-protein kinase PK7
OS=Arabidopsis thaliana GN=PK7 PE=2 SV=1
Length = 578

Score = 122 bits (307), Expect = 4e-28
Identities = 61/123 (49%), Positives = 83/123 (67%), Gaps = 1/123 (0%)
Frame = -3

Query: 368 WKALQKIRER-GEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRN 192
W A+Q++R R G + K F+ +K LG GD G+V+L EL G+G FA+K MEK+ + R
Sbjct: 163 WVAIQEVRSRVGSSLEAKDFKLIKKLGGGDIGNVYLAELIGTGVSFAVKVMEKAAIAARK 222

Query: 191 KVHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEE 12
K+ RA E+EIL LDHPFLP LY+ F+T+ + CLV +FCPGG+L L +Q K F E+
Sbjct: 223 KLVRAQTEKEILQSLDHPFLPTLYSHFETEMNSCLVMEFCPGGDLHSLRQKQRGKYFPEQ 282

Query: 11 TAR 3
AR
Sbjct: 283 AAR 285


>sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2
OS=Neurospora crassa GN=nrc-2 PE=3 SV=1
Length = 623

Score = 103 bits (258), Expect = 2e-22
Identities = 50/116 (43%), Positives = 75/116 (64%)
Frame = -3

Query: 350 IRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNKVHRACA 171
I+ R ++G + F +K +G GD G V+LV+ + SG L+A+K + K M+ RNK+ RA A
Sbjct: 230 IKVRNVEVGPQSFDKIKLIGKGDVGKVYLVKEKKSGRLYAMKVLSKKEMIKRNKIKRALA 289

Query: 170 EREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEETAR 3
E+EILA +HPF+ LY SFQ++ ++ L ++C GGE F L +P K E+ AR
Sbjct: 290 EQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCSGGEFFRALQTRPGKCIPEDDAR 345


>sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14
OS=Schizosaccharomyces pombe GN=ppk14 PE=1 SV=1
Length = 566

Score = 93.6 bits (231), Expect = 3e-19
Identities = 47/110 (42%), Positives = 67/110 (60%)
Frame = -3

Query: 332 KIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNKVHRACAEREILA 153
++G F V LG GD G V+LV + SG+ +A+K + K M+ RNK RA AE+ ILA
Sbjct: 189 EVGPSSFEKVFLLGKGDVGRVYLVREKKSGKFYAMKVLSKQEMIKRNKSKRAFAEQHILA 248

Query: 152 VLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEETAR 3
+HPF+ LY SFQ+ ++ L ++C GGE F L R+P + SE A+
Sbjct: 249 TSNHPFIVTLYHSFQSDEYLYLCMEYCMGGEFFRALQRRPGRCLSENEAK 298


>sp|P25341|KIN82_YEAST Probable serine/threonine-protein kinase
KIN82 OS=Saccharomyces cerevisiae GN=KIN82 PE=1 SV=2
Length = 720

Score = 92.0 bits (227), Expect = 8e-19
Identities = 43/104 (41%), Positives = 64/104 (61%)
Frame = -3

Query: 314 FRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNKVHRACAEREILAVLDHPF 135
F ++ LG GD G V+L+ R + ++FA+K + K M+ R K+ R E+EILA DHPF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 134 LPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEETAR 3
+ LY SFQT+ ++ L ++C GGE F L + K +EE A+
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAK 427


>sp|P53739|KN8R_YEAST Probable serine/threonine-protein kinase
YNR047W OS=Saccharomyces cerevisiae GN=YNR047W PE=1 SV=1
Length = 893

Score = 89.4 bits (220), Expect = 5e-18
Identities = 42/109 (38%), Positives = 65/109 (59%)
Frame = -3

Query: 329 IGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNKVHRACAEREILAV 150
+G + F ++ LG GD G V LV + + ++A+K + K M+ RNK+ R E+EILA
Sbjct: 491 VGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTEQEILAT 550

Query: 149 LDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEETAR 3
+HPF+ LY SFQ++ ++ L ++C GGE F L + K E+ AR
Sbjct: 551 SNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDAR 599


tr_hit_id Q765V9
Definition tr|Q765V9|Q765V9_ADICA Phototropin 2 OS=Adiantum capillus-veneris
Align length 124
Score (bit) 253.0
E-value 3.0e-66
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920986|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_B10.
(376 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q765V9|Q765V9_ADICA Phototropin 2 OS=Adiantum capillus-veneri... 253 3e-66
tr|A7NZA7|A7NZA7_VITVI Chromosome chr6 scaffold_3, whole genome ... 211 1e-53
tr|Q40269|Q40269_MESCR Protein kinase (Fragment) OS=Mesembryanth... 210 2e-53
tr|Q9ST27|Q9ST27_ORYSJ Nonphototrophic hypocotyl 1b (OSJNBa0079M... 207 3e-52
tr|Q0JEA8|Q0JEA8_ORYSJ Os04g0304200 protein (Fragment) OS=Oryza ... 207 3e-52
tr|Q01ME5|Q01ME5_ORYSA OSIGBa0092O07.5 protein OS=Oryza sativa G... 207 3e-52
tr|B8AS72|B8AS72_ORYSI Putative uncharacterized protein OS=Oryza... 207 3e-52
tr|A3AS63|A3AS63_ORYSJ Putative uncharacterized protein OS=Oryza... 207 3e-52
tr|Q5DW43|Q5DW43_PHAVU Phototropin OS=Phaseolus vulgaris GN=Pvph... 206 6e-52
tr|Q9MB43|Q9MB43_ADICA Phototropin OS=Adiantum capillus-veneris ... 205 8e-52
tr|B6SS20|B6SS20_MAIZE Phototropin-1 OS=Zea mays PE=2 SV=1 205 8e-52
tr|P93489|P93489_PEA Phototropin-like protein PsPK4 OS=Pisum sat... 205 1e-51
tr|A8MS49|A8MS49_ARATH Uncharacterized protein At5g58140.3 OS=Ar... 203 3e-51
tr|Q0GA16|Q0GA16_SOLLC Phototropin-2 OS=Solanum lycopersicum PE=... 203 4e-51
tr|A7LI54|A7LI54_SOLLC Phototropin-2 OS=Solanum lycopersicum GN=... 203 4e-51
tr|Q8RWA1|Q8RWA1_PEA Phototropin 1 OS=Pisum sativum GN=PK4 PE=4 ... 202 9e-51
tr|Q6BCU0|Q6BCU0_PHYPA Phototropin OS=Physcomitrella patens GN=P... 201 1e-50
tr|A9T7N6|A9T7N6_PHYPA PHOTA2 phototropin A2 blue light photorec... 201 1e-50
tr|Q5DW42|Q5DW42_PHAVU Phototropin OS=Phaseolus vulgaris GN=Pvph... 199 4e-50
tr|Q8H934|Q8H934_VICFA Phototropin OS=Vicia faba GN=Vfphot1b PE=... 199 6e-50
tr|A3EX92|A3EX92_SOLLC Phototropin-1 OS=Solanum lycopersicum GN=... 199 6e-50
tr|Q8H935|Q8H935_VICFA Phototropin OS=Vicia faba GN=Vfphot1a PE=... 199 7e-50
tr|Q9ST26|Q9ST26_ORYSJ Nonphototrophic hypocotyl 1a OS=Oryza sat... 198 1e-49
tr|Q5DW44|Q5DW44_PHAVU Phototropin OS=Phaseolus vulgaris GN=Pvph... 198 1e-49
tr|Q2RBR1|Q2RBR1_ORYSJ Nonphototropic hypocotyl protein 1, putat... 198 1e-49
tr|Q2QYY8|Q2QYY8_ORYSJ Os12g0101800 protein OS=Oryza sativa subs... 198 1e-49
tr|B8BLR3|B8BLR3_ORYSI Putative uncharacterized protein OS=Oryza... 198 1e-49
tr|B7ECP0|B7ECP0_ORYSJ cDNA clone:J013081N02, full insert sequen... 198 1e-49
tr|A3C7S0|A3C7S0_ORYSJ Putative uncharacterized protein OS=Oryza... 198 1e-49
tr|Q9SC66|Q9SC66_ORYSA Non-phototropic hypocotyl NPH1 OS=Oryza s... 198 1e-49

>tr|Q765V9|Q765V9_ADICA Phototropin 2 OS=Adiantum capillus-veneris
GN=PHOT2 PE=2 SV=1
Length = 1019

Score = 253 bits (647), Expect = 3e-66
Identities = 124/124 (100%), Positives = 124/124 (100%)
Frame = -3

Query: 374 DLWKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNR 195
DLWKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNR
Sbjct: 660 DLWKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNR 719

Query: 194 NKVHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSE 15
NKVHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSE
Sbjct: 720 NKVHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSE 779

Query: 14 ETAR 3
ETAR
Sbjct: 780 ETAR 783


>tr|A7NZA7|A7NZA7_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024439001
PE=4 SV=1
Length = 1021

Score = 211 bits (538), Expect = 1e-53
Identities = 99/122 (81%), Positives = 111/122 (90%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
WKA+QKI E GE+IGLKHFRPVKPLG GDTGSVHLVEL G+GE FA+KAM+K+VMLNRNK
Sbjct: 671 WKAIQKILEDGEQIGLKHFRPVKPLGSGDTGSVHLVELCGTGEYFAMKAMDKNVMLNRNK 730

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRACAEREIL +LDHPFLPALYASFQT+TH+CL+TD+CPGGELFLLLDRQP KV E+
Sbjct: 731 VHRACAEREILDMLDHPFLPALYASFQTKTHICLITDYCPGGELFLLLDRQPTKVLKEDA 790

Query: 8 AR 3
R
Sbjct: 791 VR 792


>tr|Q40269|Q40269_MESCR Protein kinase (Fragment)
OS=Mesembryanthemum crystallinum PE=2 SV=1
Length = 572

Score = 210 bits (535), Expect = 2e-53
Identities = 97/122 (79%), Positives = 111/122 (90%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
WKA++KI+E GE+IGLKHFRPVKPLG GDTGSVHLVEL G+GE FA+KAM+K+VMLNRNK
Sbjct: 221 WKAIEKIKESGEQIGLKHFRPVKPLGAGDTGSVHLVELCGTGEYFAMKAMDKNVMLNRNK 280

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRACAEREIL +LDHPFLPALYASFQT TH+CL+T++CPGGELFLLLDRQP KV E+
Sbjct: 281 VHRACAEREILDMLDHPFLPALYASFQTNTHICLITEYCPGGELFLLLDRQPTKVLKEDA 340

Query: 8 AR 3
R
Sbjct: 341 VR 342


>tr|Q9ST27|Q9ST27_ORYSJ Nonphototrophic hypocotyl 1b
(OSJNBa0079M09.13 protein) OS=Oryza sativa subsp.
japonica GN=Osnph1b PE=2 SV=1
Length = 907

Score = 207 bits (526), Expect = 3e-52
Identities = 97/122 (79%), Positives = 107/122 (87%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A++K GEKIGLKHF+PVKPLG GDTGSVHLVEL+GSGELFA+KAM+KSVMLNRNK
Sbjct: 558 WIAIEKATNLGEKIGLKHFKPVKPLGCGDTGSVHLVELQGSGELFAMKAMDKSVMLNRNK 617

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRAC EREI A+LDHPFLP LY SFQT THVCL+TDFCPGGELF +LDRQP K+F EE
Sbjct: 618 VHRACIEREIYALLDHPFLPTLYTSFQTPTHVCLITDFCPGGELFAVLDRQPMKIFREEC 677

Query: 8 AR 3
AR
Sbjct: 678 AR 679


>tr|Q0JEA8|Q0JEA8_ORYSJ Os04g0304200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0304200 PE=4 SV=1
Length = 771

Score = 207 bits (526), Expect = 3e-52
Identities = 97/122 (79%), Positives = 107/122 (87%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A++K GEKIGLKHF+PVKPLG GDTGSVHLVEL+GSGELFA+KAM+KSVMLNRNK
Sbjct: 422 WIAIEKATNLGEKIGLKHFKPVKPLGCGDTGSVHLVELQGSGELFAMKAMDKSVMLNRNK 481

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRAC EREI A+LDHPFLP LY SFQT THVCL+TDFCPGGELF +LDRQP K+F EE
Sbjct: 482 VHRACIEREIYALLDHPFLPTLYTSFQTPTHVCLITDFCPGGELFAVLDRQPMKIFREEC 541

Query: 8 AR 3
AR
Sbjct: 542 AR 543


>tr|Q01ME5|Q01ME5_ORYSA OSIGBa0092O07.5 protein OS=Oryza sativa
GN=OSIGBa0092O07.5 PE=4 SV=1
Length = 907

Score = 207 bits (526), Expect = 3e-52
Identities = 97/122 (79%), Positives = 107/122 (87%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A++K GEKIGLKHF+PVKPLG GDTGSVHLVEL+GSGELFA+KAM+KSVMLNRNK
Sbjct: 558 WIAIEKATNLGEKIGLKHFKPVKPLGCGDTGSVHLVELQGSGELFAMKAMDKSVMLNRNK 617

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRAC EREI A+LDHPFLP LY SFQT THVCL+TDFCPGGELF +LDRQP K+F EE
Sbjct: 618 VHRACIEREIYALLDHPFLPTLYTSFQTPTHVCLITDFCPGGELFAVLDRQPMKIFREEC 677

Query: 8 AR 3
AR
Sbjct: 678 AR 679


>tr|B8AS72|B8AS72_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15306 PE=4 SV=1
Length = 1015

Score = 207 bits (526), Expect = 3e-52
Identities = 97/122 (79%), Positives = 107/122 (87%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A++K GEKIGLKHF+PVKPLG GDTGSVHLVEL+GSGELFA+KAM+KSVMLNRNK
Sbjct: 666 WIAIEKATNLGEKIGLKHFKPVKPLGCGDTGSVHLVELQGSGELFAMKAMDKSVMLNRNK 725

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRAC EREI A+LDHPFLP LY SFQT THVCL+TDFCPGGELF +LDRQP K+F EE
Sbjct: 726 VHRACIEREIYALLDHPFLPTLYTSFQTPTHVCLITDFCPGGELFAVLDRQPMKIFREEC 785

Query: 8 AR 3
AR
Sbjct: 786 AR 787



Score = 63.9 bits (154), Expect = 4e-09
Identities = 27/35 (77%), Positives = 30/35 (85%)
Frame = -3

Query: 107 TQTHVCLVTDFCPGGELFLLLDRQPRKVFSEETAR 3
T THVCL+TDFCPGGELF +LDRQP K+F EE AR
Sbjct: 514 TPTHVCLITDFCPGGELFAVLDRQPMKIFREECAR 548


>tr|A3AS63|A3AS63_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_013635 PE=4 SV=1
Length = 968

Score = 207 bits (526), Expect = 3e-52
Identities = 97/122 (79%), Positives = 107/122 (87%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
W A++K GEKIGLKHF+PVKPLG GDTGSVHLVEL+GSGELFA+KAM+KSVMLNRNK
Sbjct: 619 WIAIEKATNLGEKIGLKHFKPVKPLGCGDTGSVHLVELQGSGELFAMKAMDKSVMLNRNK 678

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHRAC EREI A+LDHPFLP LY SFQT THVCL+TDFCPGGELF +LDRQP K+F EE
Sbjct: 679 VHRACIEREIYALLDHPFLPTLYTSFQTPTHVCLITDFCPGGELFAVLDRQPMKIFREEC 738

Query: 8 AR 3
AR
Sbjct: 739 AR 740


>tr|Q5DW43|Q5DW43_PHAVU Phototropin OS=Phaseolus vulgaris
GN=Pvphot1b PE=2 SV=1
Length = 987

Score = 206 bits (523), Expect = 6e-52
Identities = 94/122 (77%), Positives = 109/122 (89%)
Frame = -3

Query: 368 WKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNRNK 189
WKA+QK+ E GE+I LKHFRP+KPLG GDTGSVHLVELRG+G+ FA+KAM+K VMLNRNK
Sbjct: 634 WKAIQKVLESGEQISLKHFRPIKPLGSGDTGSVHLVELRGTGQYFAMKAMDKGVMLNRNK 693

Query: 188 VHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSEET 9
VHR CAEREIL LDHPFLPALYASFQT++HVCL+TD+CPGGELF+LLD+QP KV E+
Sbjct: 694 VHRVCAEREILDQLDHPFLPALYASFQTKSHVCLITDYCPGGELFMLLDQQPTKVLKEDA 753

Query: 8 AR 3
AR
Sbjct: 754 AR 755


>tr|Q9MB43|Q9MB43_ADICA Phototropin OS=Adiantum capillus-veneris
GN=AcNPH1 PE=2 SV=1
Length = 1092

Score = 205 bits (522), Expect = 8e-52
Identities = 93/124 (75%), Positives = 110/124 (88%)
Frame = -3

Query: 374 DLWKALQKIRERGEKIGLKHFRPVKPLGFGDTGSVHLVELRGSGELFAIKAMEKSVMLNR 195
D W ++KI GEK+ LKHFRP++PLG+GDTGSVHLVELRG+G+LFA+KAMEK+VM+ R
Sbjct: 735 DSWGVIRKIHASGEKVKLKHFRPLRPLGYGDTGSVHLVELRGTGKLFAMKAMEKNVMVKR 794

Query: 194 NKVHRACAEREILAVLDHPFLPALYASFQTQTHVCLVTDFCPGGELFLLLDRQPRKVFSE 15
NKVHR CAEREIL ++DHPFLP LYASF+TQTHVCL+TDFC GGELFLLL+RQP K+F E
Sbjct: 795 NKVHRVCAEREILGMMDHPFLPTLYASFETQTHVCLITDFCAGGELFLLLERQPTKIFRE 854

Query: 14 ETAR 3
ETAR
Sbjct: 855 ETAR 858