BP921033
Clone id YMU001_000144_G05
Library
Length 554
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000144_G05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTGTGACAAGTACACATTGCTTAAAGCATTATGATTATACAAGAAATAACATCTCGAT
GTACAAATGTTTCGGCATAGCTTCAAAAAATAGTTTCCTCTAACTAAAGGGTATCTATGT
CCCTTTCTTTGAACTAATTTGCCCAAACTAGGGAGATCACTAATTCGTACTCTGATCGAT
GCCATCATTGCTGAGCAATAACACCGACGCTTAAGGGGGGAAATAATCATGTCAGCAAAA
CTGTTAACTGGACAATTTTCCCATGCGACCAAAAACTGCATGCAGCACGCAGGTTCCTAT
GCCAATCATACCGGATCCTGCCATTAACCAATTCGAAAGGTAGCTTGTTGCTTGACCGGT
TCTGGCTCTGGCTCTGGCCCCTTCTCCTTCTCAAGCTCCTTGGTTGGAAATGTCAATAAT
ACTTCATAAGCTGCTGAAAGCTCCCCTCTGGCCTTCTGATGCCCTATTGACCTGGCCGAC
TCTTTGAAAAAAGCCTCAAATAGTTCCTCGTAGTCAGATTTCACACAAATACAGTCCTCT
CTTCGGCAATCAGG
■■Homology search results ■■ -
sp_hit_id Q8BL99
Definition sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus
Align length 77
Score (bit) 31.6
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921033|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_G05.
(554 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 P... 32 2.7
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 P... 32 2.7

>sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1
SV=2
Length = 2399

Score = 31.6 bits (70), Expect = 2.7
Identities = 23/77 (29%), Positives = 35/77 (45%)
Frame = -1

Query: 296 EPACCMQFLVAWENCPVNSFADMIISPLKRRCYCSAMMASIRVRISDLPSLGKLVQRKGH 117
+P +Q+L A F +I L + C C I + S LP +GK++QR
Sbjct: 1616 QPMTSLQYLHAQPITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQR--- 1672

Query: 116 RYPLVRGNYFLKLCRNI 66
V + L+LCRN+
Sbjct: 1673 ----VVVSVTLQLCRNL 1685


>sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=1
SV=1
Length = 2465

Score = 31.6 bits (70), Expect = 2.7
Identities = 23/77 (29%), Positives = 35/77 (45%)
Frame = -1

Query: 296 EPACCMQFLVAWENCPVNSFADMIISPLKRRCYCSAMMASIRVRISDLPSLGKLVQRKGH 117
+P +Q+L A F +I L + C C I + S LP +GK++QR
Sbjct: 1621 QPMTSLQYLHAQPITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQR--- 1677

Query: 116 RYPLVRGNYFLKLCRNI 66
V + L+LCRN+
Sbjct: 1678 ----VVVSVTLQLCRNL 1690


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921033|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_G05.
(554 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******