BP921042
Clone id YMU001_000144_H03
Library
Length 472
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000144_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACATGCTAAGGAATTCAAGTTGAATCCGAATGCAAAGTCTTTTACACCAAATTTACCCC
TCTTAGGCCTCCTTCCCCGATTGTTCAAGCTTCATCATATGTCCCTGGGATGGTACCTCA
AGGTGCTCCAGCGCAAAATGTGCCTTTGGGTGTTCCCAGCAACCCTCAGACACCACAGGT
AGGGCAGCCTGCCTCCAAGTATACACCGTATAACAACATGACAGTATCTGGAGCCTCAGG
TGGACCTCCCTTCTTACCACCTCCGCCAGCATTTATAAGCGGGCAAGCTCCAATGAAAGT
CCCTTCTCAGCTGCAACAGCCAGCTATGGGCAATTCATATGGTCAACATCAGCCAGTCAG
ATATCCTTCCCAGGCTCCTGTCATGCAGTCCTCATCAACATATATGCATCCTAATGGTCA
TCTGTATGCACAGCAAATGATGTTTGGTCAGCCTGCGCAAGTCGTTTATTAT
■■Homology search results ■■ -
sp_hit_id Q8IN94
Definition sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster
Align length 137
Score (bit) 40.8
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921042|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_H03.
(472 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila me... 41 0.003
sp|Q8K2K6|AGFG1_MOUSE Arf-GAP domain and FG repeats-containing p... 36 0.099
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery ... 35 0.13
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery ... 35 0.13
sp|Q9SQV1|RH40_ARATH Probable DEAD-box ATP-dependent RNA helicas... 33 0.49
sp|P08489|GLT4_WHEAT Glutenin, high molecular weight subunit PW2... 33 0.49
sp|Q2T9N0|FSCB_BOVIN Fibrous sheath CABYR-binding protein OS=Bos... 33 0.64
sp|Q8VDM6|HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-... 33 0.84
sp|A4RD35|SEC31_MAGGR Protein transport protein SEC31 OS=Magnapo... 32 1.1
sp|P10388|GLT5_WHEAT Glutenin, high molecular weight subunit DX5... 32 1.1
sp|Q03173|ENAH_MOUSE Protein enabled homolog OS=Mus musculus GN=... 32 1.1
sp|Q6FWD3|SC242_CANGA Protein transport protein SEC24-2 OS=Candi... 32 1.4
sp|Q61L47|MED15_CAEBR Mediator of RNA polymerase II transcriptio... 32 1.4
sp|Q9BUJ2|HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-... 32 1.4
sp|Q7S747|EPL1_NEUCR Enhancer of polycomb-like protein 1 OS=Neur... 32 1.4
sp|Q2TA45|AGFG1_BOVIN Arf-GAP domain and FG repeats-containing p... 32 1.4
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 1... 32 1.9
sp|O35569|NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=R... 31 2.4
sp|P56974|NRG2_MOUSE Pro-neuregulin-2, membrane-bound isoform OS... 31 2.4
sp|P49750|YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sap... 31 3.2
sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=S... 31 3.2
sp|Q4KJL8|TATB_PSEF5 Sec-independent protein translocase protein... 31 3.2
sp|Q80TZ9|RERE_MOUSE Arginine-glutamic acid dipeptide repeats pr... 31 3.2
sp|Q5B5B0|PAN1_EMENI Actin cytoskeleton-regulatory complex prote... 31 3.2
sp|Q60YF6|MED29_CAEBR Mediator of RNA polymerase II transcriptio... 31 3.2
sp|Q71SY5|MED25_HUMAN Mediator of RNA polymerase II transcriptio... 31 3.2
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musc... 31 3.2
sp|A0JM64|K0907_XENTR UPF0469 protein KIAA0907 homolog OS=Xenopu... 31 3.2
sp|O13598|YNI8_SCHPO WW domain-containing protein C11B10.08 OS=S... 30 4.2
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergi... 30 4.2

>sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila
melanogaster GN=osa PE=1 SV=1
Length = 2716

Score = 40.8 bits (94), Expect = 0.003
Identities = 38/137 (27%), Positives = 46/137 (33%), Gaps = 11/137 (8%)
Frame = +2

Query: 56 TPLRPPS-----------PIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKY 202
+PLRPPS P Q S G VPQ P Q GVPS P PQVG
Sbjct: 1622 SPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPS-PGLPQVGPGGMVK 1680

Query: 203 TPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPV 382
PY + Q P +P Q Q Q P+
Sbjct: 1681 PPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQAMQ-----------------QQPL 1723

Query: 383 MQSSSTYMHPNGHLYAQ 433
Q ++ HP+ H + Q
Sbjct: 1724 QQQPPSHQHPHPHQHPQ 1740



Score = 29.6 bits (65), Expect = 7.1
Identities = 31/119 (26%), Positives = 37/119 (31%)
Frame = +2

Query: 56 TPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXX 235
+P RPP Y+PG PQG L SNP P + A+ Y P
Sbjct: 193 SPNRPPQ-----QRYIPGQPPQGPTPTLNSLLQSSNPPPPPQHRYANTYDPQQAAASAAA 247

Query: 236 XXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPVMQSSSTYMHP 412
G P P Q Q G G P P +P + S Y P
Sbjct: 248 AAAAQQQQAGGPPPPGHGP--PPPQHQPSPYGGQQGGWAPPPRP-YSPQLGPSQQYRTP 303


>sp|Q8K2K6|AGFG1_MOUSE Arf-GAP domain and FG repeats-containing
protein 1 OS=Mus musculus GN=Agfg1 PE=1 SV=2
Length = 561

Score = 35.8 bits (81), Expect = 0.099
Identities = 46/157 (29%), Positives = 59/157 (37%), Gaps = 14/157 (8%)
Frame = +2

Query: 38 VFYTKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLG--------VPS-NPQTPQVGQP 190
VF + T +P ASS V G VP GA AQ P PS NP G
Sbjct: 383 VFSSAATSSNAYTPTSNASSSVFGTVPVGASAQTQPASSGPAPFGATPSTNPFVAATGPS 442

Query: 191 ASKYT-PYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPA---MGNSY-GQHQP 355
A+ T P+ G A M +P+ PA + S+ G Q
Sbjct: 443 AASSTNPFQTNA-----------RGATAATFGTASMSMPAGFGTPAQYSLPTSFSGSFQQ 491

Query: 356 VRYPSQAPVMQSSSTYMHPNGHLYAQQMMFGQPAQVV 466
+P+QA Q ++ PNG +A FGQ VV
Sbjct: 492 PAFPAQAAFPQQTAFSQQPNGAGFA---TFGQTKPVV 525


>sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery
protein HSE1 OS=Phaeosphaeria nodorum GN=HSE1 PE=3 SV=1
Length = 618

Score = 35.4 bits (80), Expect = 0.13
Identities = 28/116 (24%), Positives = 37/116 (31%), Gaps = 9/116 (7%)
Frame = +2

Query: 74 SPIVQASSYVPGMVPQGAPA---------QNVPLGVPSNPQTPQVGQPASKYTPYNNMTV 226
SP+ S+ PQGAP+ P G P P G P + PY ++
Sbjct: 486 SPVDNRHSFAGPSQPQGAPSAPQGYEYPPSQAPPGYPPQQGAPLQGPPPGQQNPYEQISS 545

Query: 227 XXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPVMQSS 394
+ Q P P P +G+ Y QP P P SS
Sbjct: 546 PP---------------THQQPPSDPYSQPPPQVGHGYPPQQPAHAPPAPPGASSS 586



Score = 32.0 bits (71), Expect = 1.4
Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 15/68 (22%)
Frame = +2

Query: 47 TKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNP---------------QTPQV 181
+ +T P SP Q Y G PQG+ Q P+G +NP QTPQ
Sbjct: 394 SNYTGYPPSSPPPQQYGYGAGAPPQGSAPQYPPVG--ANPAFFMVPPAGEQRPQQQTPQP 451

Query: 182 GQPASKYT 205
G P+ Y+
Sbjct: 452 GPPSDPYS 459


>sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery
protein HSE1 OS=Chaetomium globosum GN=HSE1 PE=3 SV=1
Length = 713

Score = 35.4 bits (80), Expect = 0.13
Identities = 33/126 (26%), Positives = 46/126 (36%), Gaps = 19/126 (15%)
Frame = +2

Query: 59 PLRPPSPIVQASSYVPGMVPQ---------GAPAQNVPLGVPSNPQTPQVGQPASKYTP- 208
PL+ S A+ Y P PQ G+ Q + V +P PQ PA+ Y P
Sbjct: 471 PLQTSSSPPPANQYTPYQAPQSSARPQSTYGSGPQELSTSVYDSPIAPQNANPAAPYPPS 530

Query: 209 ------YNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMG---NSYGQHQPVR 361
+ T S AP +LQQP+ G ++Y H P +
Sbjct: 531 AYATPDEDPYTAAAASNSSVPTAPTVPPPSVPAPSAPSPELQQPSYGQPYSAYHAHPPQQ 590

Query: 362 YPSQAP 379
P +AP
Sbjct: 591 TPYRAP 596



Score = 29.3 bits (64), Expect = 9.3
Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)
Frame = +2

Query: 68 PPSPIVQASSYVPGMVPQGAPAQNVPLG--VPSNPQTPQVGQPASKYTPY 211
PP+P Q+ Q Q VP G P+ QT PA++YTPY
Sbjct: 438 PPTPQQQSQQPQQPQYAQRPSEQRVPSGGKQPAPLQTSSSPPPANQYTPY 487


>sp|Q9SQV1|RH40_ARATH Probable DEAD-box ATP-dependent RNA helicase
40 OS=Arabidopsis thaliana GN=RH40 PE=3 SV=1
Length = 1088

Score = 33.5 bits (75), Expect = 0.49
Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
Frame = +2

Query: 284 QAPMKVPSQLQQPAMGNSY-GQHQPVRYPSQAPVMQSSSTYMHPNGH 421
Q P + PSQ +P M + Q P + Q P QS S HP+GH
Sbjct: 98 QQPQQFPSQHVRPQMMQQHPAQQMPQQSGQQFPQQQSQSMVPHPHGH 144


>sp|P08489|GLT4_WHEAT Glutenin, high molecular weight subunit PW212
OS=Triticum aestivum PE=3 SV=1
Length = 838

Score = 33.5 bits (75), Expect = 0.49
Identities = 40/126 (31%), Positives = 45/126 (35%), Gaps = 1/126 (0%)
Frame = +2

Query: 86 QASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXXXXXXXX 265
Q SY PG P Q G Q Q GQ Y P T
Sbjct: 119 QQVSYYPGQASPQRPGQGQQPG-----QGQQSGQGQQGYYP----TSPQQPGQWQQPEQG 169

Query: 266 XXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQA-PVMQSSSTYMHPNGHLYAQQMM 442
+P + P QLQQPA G GQ Q R P Q P +S+ + P G L QQ
Sbjct: 170 QPGYYPTSPQQ-PGQLQQPAQGQQPGQGQQGRQPGQGQPGYYPTSSQLQP-GQL--QQPA 225

Query: 443 FGQPAQ 460
GQ Q
Sbjct: 226 QGQQGQ 231



Score = 31.2 bits (69), Expect = 2.4
Identities = 38/134 (28%), Positives = 44/134 (32%), Gaps = 3/134 (2%)
Frame = +2

Query: 68 PPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXX 247
P SP PG Q P Q P P++P P GQP Y P +
Sbjct: 503 PTSPQQSGQGQQPGQWQQ--PGQGQPGYYPTSPLQPGQGQPG--YDPTSPQQ-------- 550

Query: 248 XXXXXXXXXISGQAPMKVPSQLQQPA---MGNSYGQHQPVRYPSQAPVMQSSSTYMHPNG 418
GQ + P QLQQPA G Q Q + P+Q V Q G
Sbjct: 551 ----------PGQG--QQPGQLQQPAQGQQGQQLAQGQQGQQPAQ--VQQGQQPAQGQQG 596

Query: 419 HLYAQQMMFGQPAQ 460
Q QP Q
Sbjct: 597 QQLGQGQQGQQPGQ 610



Score = 29.3 bits (64), Expect = 9.3
Identities = 28/91 (30%), Positives = 32/91 (35%), Gaps = 2/91 (2%)
Frame = +2

Query: 104 PGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXXXXXXXXXXXISG 283
PG Q P Q P P++PQ GQP T T G
Sbjct: 353 PGQGQQ--PGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPG------------QG 398

Query: 284 QAPMKVPS--QLQQPAMGNSYGQHQPVRYPS 370
Q +V Q QQP G GQ QP YP+
Sbjct: 399 QQGQQVGQGQQAQQPGQGQQPGQGQPGYYPT 429


>sp|Q2T9N0|FSCB_BOVIN Fibrous sheath CABYR-binding protein OS=Bos
taurus GN=FSCB PE=2 SV=1
Length = 818

Score = 33.1 bits (74), Expect = 0.64
Identities = 30/129 (23%), Positives = 50/129 (38%), Gaps = 3/129 (2%)
Frame = +2

Query: 77 PIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXXXXX 256
P +A + P V Q PA+ VP G P Q+P + ++ P
Sbjct: 476 PAEEAPAEEPPEV-QSPPAEEVPAGEPPEVQSPPAEEAPAEEAPEVQSPPAEEVPAEEAL 534

Query: 257 XXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQP-VRYP--SQAPVMQSSSTYMHPNGHLY 427
+ +AP PS++Q P + + P V+ P +AP ++ P G
Sbjct: 535 AEVEPPPAEEAPAGEPSEVQSPPAEEAPAEEAPEVQSPPSEEAPAEEAPEVQSVPAGQAP 594

Query: 428 AQQMMFGQP 454
A++ + QP
Sbjct: 595 AEEPLEVQP 603


>sp|Q8VDM6|HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like
protein 1 OS=Mus musculus GN=Hnrnpul1 PE=2 SV=1
Length = 859

Score = 32.7 bits (73), Expect = 0.84
Identities = 34/133 (25%), Positives = 44/133 (33%), Gaps = 8/133 (6%)
Frame = +2

Query: 59 PLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVP---SNPQTPQVG-----QPASKYTPYN 214
P +PP P SY P P GA + N +P +N TP V QP+ PYN
Sbjct: 711 PQQPPPP----PSYSPARNPPGASSYNKNSNIPGSSANTSTPTVSSYTPPQPSYSQPPYN 766

Query: 215 NMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPVMQSS 394
G P SYG + P Y P ++
Sbjct: 767 Q----------------GGYTQGYTAPPPPPPPPPAYNYGSYGPYNPAPYTPPPP--PTA 808

Query: 395 STYMHPNGHLYAQ 433
TY P+ + Y Q
Sbjct: 809 QTYPQPSYNQYQQ 821


>sp|A4RD35|SEC31_MAGGR Protein transport protein SEC31 OS=Magnaporthe
grisea GN=SEC31 PE=3 SV=1
Length = 1269

Score = 32.3 bits (72), Expect = 1.1
Identities = 33/130 (25%), Positives = 44/130 (33%), Gaps = 15/130 (11%)
Frame = +2

Query: 68 PPSPIVQASSY---------------VPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKY 202
PPS V A S+ P + P +P N G+ PQ+P +GQ +
Sbjct: 914 PPSRTVDAGSWNDVPMVTKAPPPRRSTPSVAPVPSPFANQQAGMAPPPQSPYLGQRGTAT 973

Query: 203 TPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPV 382
P +GQ P ++ S L P YG P R P
Sbjct: 974 PP------------------PPPPKAGQGPPRMASPLTSPPQA-GYGGAAPPR-----PA 1009

Query: 383 MQSSSTYMHP 412
+SSTY P
Sbjct: 1010 SAASSTYAPP 1019


>sp|P10388|GLT5_WHEAT Glutenin, high molecular weight subunit DX5
OS=Triticum aestivum GN=GLU-1D-1D PE=3 SV=4
Length = 839

Score = 32.3 bits (72), Expect = 1.1
Identities = 39/132 (29%), Positives = 48/132 (36%), Gaps = 7/132 (5%)
Frame = +2

Query: 86 QASSYVPGMVPQGAPAQNVPLG------VPSNPQTPQVGQPASKYTPYNNMTVXXXXXXX 247
Q SY PG P Q G P++PQ P Q + P T
Sbjct: 120 QQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPGYYPT-------- 171

Query: 248 XXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQA-PVMQSSSTYMHPNGHL 424
+P + P QLQQPA G GQ Q + P Q P +S+ + P G L
Sbjct: 172 -------------SPQQ-PGQLQQPAQGQQPGQGQQGQQPGQGQPGYYPTSSQLQP-GQL 216

Query: 425 YAQQMMFGQPAQ 460
QQ GQ Q
Sbjct: 217 --QQPAQGQQGQ 226



Score = 31.2 bits (69), Expect = 2.4
Identities = 38/134 (28%), Positives = 44/134 (32%), Gaps = 3/134 (2%)
Frame = +2

Query: 68 PPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXX 247
P SP PG Q P Q P P++P P GQP Y P +
Sbjct: 498 PTSPQQSGQGQQPGQWQQ--PGQGQPGYYPTSPLQPGQGQPG--YDPTSPQQ-------- 545

Query: 248 XXXXXXXXXISGQAPMKVPSQLQQPA---MGNSYGQHQPVRYPSQAPVMQSSSTYMHPNG 418
GQ + P QLQQPA G Q Q + P+Q V Q G
Sbjct: 546 ----------PGQG--QQPGQLQQPAQGQQGQQLAQGQQGQQPAQ--VQQGQQPAQGQQG 591

Query: 419 HLYAQQMMFGQPAQ 460
Q QP Q
Sbjct: 592 QQLGQGQQGQQPGQ 605



Score = 29.3 bits (64), Expect = 9.3
Identities = 28/91 (30%), Positives = 32/91 (35%), Gaps = 2/91 (2%)
Frame = +2

Query: 104 PGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKYTPYNNMTVXXXXXXXXXXXXXXXXISG 283
PG Q P Q P P++PQ GQP T T G
Sbjct: 348 PGQGQQ--PGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPG------------QG 393

Query: 284 QAPMKVPS--QLQQPAMGNSYGQHQPVRYPS 370
Q +V Q QQP G GQ QP YP+
Sbjct: 394 QQGQQVGQGQQAQQPGQGQQPGQGQPGYYPT 424


tr_hit_id A7P6L1
Definition tr|A7P6L1|A7P6L1_VITVI Chromosome chr9 scaffold_7, whole genome shotgun sequence OS=Vitis vinifera
Align length 151
Score (bit) 59.3
E-value 1.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921042|Adiantum capillus-veneris mRNA, clone:
YMU001_000144_H03.
(472 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P6L1|A7P6L1_VITVI Chromosome chr9 scaffold_7, whole genome ... 59 1e-11
tr|A5AZZ6|A5AZZ6_VITVI Putative uncharacterized protein OS=Vitis... 59 1e-11
tr|A5AE72|A5AE72_VITVI Putative uncharacterized protein OS=Vitis... 51 3e-06
tr|A2PZE4|A2PZE4_IPONI Ataxin-2 related protein OS=Ipomoea nil G... 40 2e-05
tr|A7P0R6|A7P0R6_VITVI Chromosome chr19 scaffold_4, whole genome... 51 3e-05
tr|A9TXE8|A9TXE8_PHYPA Predicted protein OS=Physcomitrella paten... 49 1e-04
tr|Q8RY61|Q8RY61_ARATH AT4g26990/F10M23_330 OS=Arabidopsis thali... 47 6e-04
tr|Q9SZ38|Q9SZ38_ARATH Putative uncharacterized protein F10M23.3... 45 0.001
tr|B5HB41|B5HB41_STRPR Putative uncharacterized protein OS=Strep... 42 0.015
tr|Q7KSE8|Q7KSE8_DROME Osa, isoform C OS=Drosophila melanogaster... 41 0.034
tr|B6IDZ6|B6IDZ6_DROME LD42748p (Fragment) OS=Drosophila melanog... 41 0.034
tr|B4IBE1|B4IBE1_DROSE GM15347 OS=Drosophila sechellia GN=GM1534... 40 0.058
tr|Q9LVJ8|Q9LVJ8_ARATH Arabidopsis thaliana genomic DNA, chromos... 31 0.079
tr|Q94AM9|Q94AM9_ARATH Putative uncharacterized protein At3g1401... 31 0.079
tr|B4PKH8|B4PKH8_DROYA Osa OS=Drosophila yakuba GN=Dyak\osa PE=4... 39 0.13
tr|A2DW41|A2DW41_TRIVA Putative uncharacterized protein OS=Trich... 39 0.13
tr|Q5YRU1|Q5YRU1_NOCFA Putative serine/threonine protein kinase ... 39 0.17
tr|B7PJC1|B7PJC1_IXOSC WW domain-binding protein, putative OS=Ix... 39 0.17
tr|Q6K2L9|Q6K2L9_ORYSJ Os02g0480900 protein OS=Oryza sativa subs... 38 0.22
tr|Q092Q1|Q092Q1_STIAU TonB-dependent receptor OS=Stigmatella au... 38 0.29
tr|A4VA22|A4VA22_DROSI CG16743 protein (Fragment) OS=Drosophila ... 38 0.29
tr|Q6C5E4|Q6C5E4_YARLI YALI0E18766p OS=Yarrowia lipolytica GN=YA... 38 0.29
tr|Q7TVF9|Q7TVF9_MYCBO HYPOTHETICAL ALANINE AND PROLINE RICH PRO... 37 0.38
tr|A4KMZ4|A4KMZ4_MYCTU Hypothetical alanine and proline rich pro... 37 0.38
tr|Q8T5C4|Q8T5C4_AEDAE Peritrophin OS=Aedes aegypti PE=2 SV=1 37 0.38
tr|Q17I34|Q17I34_AEDAE Putative uncharacterized protein OS=Aedes... 37 0.38
tr|B4HWY5|B4HWY5_DROSE GM18772 OS=Drosophila sechellia GN=GM1877... 37 0.38
tr|A4VA21|A4VA21_DROSI CG16743 protein (Fragment) OS=Drosophila ... 37 0.38
tr|A2F881|A2F881_TRIVA Calcium-binding protein, putative OS=Tric... 37 0.38
tr|B3P0H1|B3P0H1_DROER GG16758 OS=Drosophila erecta GN=GG16758 P... 37 0.49

>tr|A7P6L1|A7P6L1_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034112001
PE=4 SV=1
Length = 641

Score = 59.3 bits (142), Expect(2) = 1e-11
Identities = 44/151 (29%), Positives = 56/151 (37%)
Frame = +2

Query: 17 QVESECKVFYTKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPAS 196
++ K F TP+RPPSP+ S Y P VP+ P
Sbjct: 533 KLNPNAKSFIPSQTPVRPPSPVSDGSFYFP-------------TNVPAIPH--------- 570

Query: 197 KYTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQA 376
M VP + +G+S+ HQPV + QA
Sbjct: 571 --------------------------------MHVPVGV---GIGHSFSGHQPVIFNPQA 595

Query: 377 PVMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
+QS TY HPNG Y QQM FG P QV+Y
Sbjct: 596 APIQSPQTYFHPNGPQYGQQMFFGHPRQVLY 626



Score = 33.5 bits (75), Expect(2) = 1e-11
Identities = 14/14 (100%), Positives = 14/14 (100%)
Frame = +3

Query: 3 HAKEFKLNPNAKSF 44
HAKEFKLNPNAKSF
Sbjct: 528 HAKEFKLNPNAKSF 541


>tr|A5AZZ6|A5AZZ6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_039723 PE=4 SV=1
Length = 261

Score = 59.3 bits (142), Expect(2) = 1e-11
Identities = 44/151 (29%), Positives = 56/151 (37%)
Frame = +2

Query: 17 QVESECKVFYTKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPAS 196
++ K F TP+RPPSP+ S Y P VP+ P
Sbjct: 131 KLNPNAKSFIPSQTPVRPPSPVSDGSFYFP-------------TNVPAIPH--------- 168

Query: 197 KYTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQA 376
M VP + +G+S+ HQPV + QA
Sbjct: 169 --------------------------------MHVPVGV---GIGHSFSGHQPVIFNPQA 193

Query: 377 PVMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
+QS TY HPNG Y QQM FG P QV+Y
Sbjct: 194 APIQSPQTYFHPNGPQYGQQMFFGHPRQVLY 224



Score = 33.5 bits (75), Expect(2) = 1e-11
Identities = 14/14 (100%), Positives = 14/14 (100%)
Frame = +3

Query: 3 HAKEFKLNPNAKSF 44
HAKEFKLNPNAKSF
Sbjct: 126 HAKEFKLNPNAKSF 139


>tr|A5AE72|A5AE72_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016662 PE=4 SV=1
Length = 558

Score = 51.2 bits (121), Expect(2) = 3e-06
Identities = 46/150 (30%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
Frame = +2

Query: 35 KVFYTKFTPLR----PPSPIVQASSYVPGMVPQGAPAQNVP-LGVPSNPQTPQVGQPASK 199
KVF FT R P P V + +YVP A + P +G+ +P P+ P K
Sbjct: 344 KVFSPSFTHPRSVTPPAVPAVASVAYVPNNSTVVPVASSQPEIGI--SPFAPRSSLPV-K 400

Query: 200 YTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAP 379
+ PY+N+ I+G SQ QP +G+ + QPVRY Q
Sbjct: 401 FVPYSNL------------------IAGNGGSG--SQYSQPIIGHMASRLQPVRYAGQYQ 440

Query: 380 VMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
+Q+ Y+HPN +Q +M G+ Q+VY
Sbjct: 441 PVQAGPAYVHPN----SQAVMVGRLGQLVY 466



Score = 23.1 bits (48), Expect(2) = 3e-06
Identities = 10/14 (71%), Positives = 11/14 (78%)
Frame = +3

Query: 6 AKEFKLNPNAKSFT 47
AKE KLNP AK F+
Sbjct: 334 AKESKLNPGAKVFS 347


>tr|A2PZE4|A2PZE4_IPONI Ataxin-2 related protein OS=Ipomoea nil
GN=In25 PE=2 SV=1
Length = 616

Score = 40.4 bits (93), Expect(2) = 2e-05
Identities = 37/151 (24%), Positives = 47/151 (31%)
Frame = +2

Query: 17 QVESECKVFYTKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPAS 196
++ K F TPLRP SP+ S Y P V Q + +G+ P P +
Sbjct: 509 KLNPNAKSFVPSPTPLRPASPVSDGSLYYPANVAAVPHMQGMTVGIGIAP-------PFT 561

Query: 197 KYTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQA 376
Y PY Y Q
Sbjct: 562 GYQPY-----------------------------------------IYNQQ--------- 571

Query: 377 PVMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
V + Y HPNG Y QQM+ G P QV+Y
Sbjct: 572 -VTPAPQPYYHPNGPQYGQQMLLGHPRQVMY 601



Score = 31.2 bits (69), Expect(2) = 2e-05
Identities = 13/14 (92%), Positives = 14/14 (100%)
Frame = +3

Query: 3 HAKEFKLNPNAKSF 44
+AKEFKLNPNAKSF
Sbjct: 504 YAKEFKLNPNAKSF 517


>tr|A7P0R6|A7P0R6_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027334001
PE=4 SV=1
Length = 242

Score = 51.2 bits (121), Expect = 3e-05
Identities = 46/150 (30%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
Frame = +2

Query: 35 KVFYTKFTPLR----PPSPIVQASSYVPGMVPQGAPAQNVP-LGVPSNPQTPQVGQPASK 199
KVF FT R P P V + +YVP A + P +G+ +P P+ P K
Sbjct: 28 KVFSPSFTHPRSVTPPAVPAVASVAYVPNNSTVVPVASSQPEIGI--SPFAPRSSLPV-K 84

Query: 200 YTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAP 379
+ PY+N+ I+G SQ QP +G+ + QPVRY Q
Sbjct: 85 FVPYSNL------------------IAGNGGSG--SQYSQPIIGHMASRLQPVRYAGQYQ 124

Query: 380 VMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
+Q+ Y+HPN +Q +M G+ Q+VY
Sbjct: 125 PVQAGPAYVHPN----SQAVMVGRLGQLVY 150


>tr|A9TXE8|A9TXE8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_172528 PE=4 SV=1
Length = 956

Score = 48.9 bits (115), Expect = 1e-04
Identities = 25/66 (37%), Positives = 33/66 (50%)
Frame = +2

Query: 275 ISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPVMQSSSTYMHPNGHLYAQQMMFGQP 454
+ GQ M+V S QQ A+ YG Q V++P Q +HPN LY MM+GQP
Sbjct: 806 LPGQPNMRVASHSQQQAL--PYGHPQQVKFPMQPSTSAMQPGLLHPNSQLYPPHMMYGQP 863

Query: 455 AQVVYY 472
V +
Sbjct: 864 GSPVMF 869



Score = 34.3 bits (77), Expect = 3.2
Identities = 14/15 (93%), Positives = 15/15 (100%)
Frame = +3

Query: 3 HAKEFKLNPNAKSFT 47
HAKEFKLNPNAK+FT
Sbjct: 700 HAKEFKLNPNAKAFT 714


>tr|Q8RY61|Q8RY61_ARATH AT4g26990/F10M23_330 OS=Arabidopsis thaliana
PE=2 SV=1
Length = 474

Score = 46.6 bits (109), Expect = 6e-04
Identities = 39/155 (25%), Positives = 65/155 (41%), Gaps = 4/155 (2%)
Frame = +2

Query: 17 QVESECKVFYTKFTPLRPPSPI----VQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVG 184
++ E K+F +T PSP+ V +Y+P P + + V +NP PQ
Sbjct: 253 KLNPEAKIFSPSYTKRLSPSPVGMPHVGNIAYIPSNTPMLPVPEAIYPEVVNNPYVPQ-A 311

Query: 185 QPASKYTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRY 364
P SK+ PY N+T + G Q Q +G + + QP RY
Sbjct: 312 PPPSKFVPYGNVTA-------------GHAVGG-------FQFPQHMIGPTVNRAQPQRY 351

Query: 365 PSQAPVMQSSSTYMHPNGHLYAQQMMFGQPAQVVY 469
+Q +Q++ ++P + Q+M + Q+VY
Sbjct: 352 TAQYHSVQAAPMLVNP-----SPQVMVARSGQLVY 381


>tr|Q9SZ38|Q9SZ38_ARATH Putative uncharacterized protein F10M23.330
(Putative uncharacterized protein AT4g26990)
OS=Arabidopsis thaliana GN=F10M23.330 PE=4 SV=1
Length = 537

Score = 45.4 bits (106), Expect = 0.001
Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 6/157 (3%)
Frame = +2

Query: 17 QVESECKVFYTKFTPLRPPSPI----VQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVG 184
++ E K+F +T PSP+ V +Y+P P + + V +NP PQ
Sbjct: 313 KLNPEAKIFSPSYTKRLSPSPVGMPHVGNIAYIPSNTPMLPVPEAIYPEVVNNPYVPQA- 371

Query: 185 QPASKYTPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRY 364
P SK+ PY N+T + G Q Q +G + + QP RY
Sbjct: 372 LPPSKFVPYGNVTA-------------GHAVGG-------FQFPQHMIGPTVNRAQPQRY 411

Query: 365 PSQAPVMQSSSTYMHPNGH--LYAQQMMFGQPAQVVY 469
+Q +Q++ ++P+ Q+M + Q+VY
Sbjct: 412 TAQYHSVQAAPMLVNPSPQTLFTVLQVMVARSGQLVY 448


>tr|B5HB41|B5HB41_STRPR Putative uncharacterized protein
OS=Streptomyces pristinaespiralis ATCC 25486
GN=SSDG_02450 PE=4 SV=1
Length = 313

Score = 42.0 bits (97), Expect = 0.015
Identities = 34/114 (29%), Positives = 42/114 (36%), Gaps = 1/114 (0%)
Frame = +2

Query: 47 TKFTPLRPPSPIVQASSYVPGMVPQGAPAQNVPLGVP-SNPQTPQVGQPASKYTPYNNMT 223
T P+ PP+ G VP AP+ P G P PQ PQ GQ +
Sbjct: 6 TMAAPMTPPA----------GTVPPPAPS---PYGQPPQQPQQPQYGQVPGQ-------- 44

Query: 224 VXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPVM 385
+ GQ P ++P Q QP M + YGQ P Y Q P M
Sbjct: 45 -----------------MPGQVPGQMPGQAPQPGMPSPYGQQAPAPYGQQPPGM 81


>tr|Q7KSE8|Q7KSE8_DROME Osa, isoform C OS=Drosophila melanogaster
GN=osa PE=2 SV=1
Length = 2556

Score = 40.8 bits (94), Expect = 0.034
Identities = 38/137 (27%), Positives = 46/137 (33%), Gaps = 11/137 (8%)
Frame = +2

Query: 56 TPLRPPS-----------PIVQASSYVPGMVPQGAPAQNVPLGVPSNPQTPQVGQPASKY 202
+PLRPPS P Q S G VPQ P Q GVPS P PQVG
Sbjct: 1462 SPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPS-PGLPQVGPGGMVK 1520

Query: 203 TPYNNMTVXXXXXXXXXXXXXXXXISGQAPMKVPSQLQQPAMGNSYGQHQPVRYPSQAPV 382
PY + Q P +P Q Q Q P+
Sbjct: 1521 PPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQAMQ-----------------QQPL 1563

Query: 383 MQSSSTYMHPNGHLYAQ 433
Q ++ HP+ H + Q
Sbjct: 1564 QQQPPSHQHPHPHQHPQ 1580