BP921066
Clone id YMU001_000145_B11
Library
Length 342
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000145_B11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTTTGAAAGAATAGTCAGTGCTTGTGAATATTGACTGTTCATACAAT
ATCATTGCCAAAACATGACTTTGGTAGCCCATCTTTGCACAAAGGAAAACTCGATCAGTA
AAGATTATCAGAGGCAGATAGTATCTAAAAAGACTACCACTTTTTCATGGGGCACATGAT
AATCTACCTTTGCAACTTTCTCTCCTGCCCCAAAATAGCACATACAATCCGACAGCGTAG
AACAAGGGCACTTATTGATTAGTGTACATTTGGATGACAATGATAACCACCCACAATAAG
GGTGGATTTTCAGAAAAAGGGATATCTAAAGCCGAAGGTGTA
■■Homology search results ■■ -
sp_hit_id Q9V4A7
Definition sp|Q9V4A7|PLXB_DROME Plexin-B OS=Drosophila melanogaster
Align length 50
Score (bit) 36.2
E-value 0.052
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921066|Adiantum capillus-veneris mRNA, clone:
YMU001_000145_B11.
(308 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9V4A7|PLXB_DROME Plexin-B OS=Drosophila melanogaster GN=plex... 36 0.052
sp|P62932|FBX40_MOUSE F-box only protein 40 OS=Mus musculus GN=F... 33 0.58
sp|Q9JN46|AAM1_RHOSH Putative glycosidase (Fragment) OS=Rhodobac... 31 2.2
sp|Q01347|VU9_HHV6U Protein U9 OS=Human herpesvirus 6A (strain U... 29 6.4
sp|Q646C0|T2R46_PANTR Taste receptor type 2 member 46 OS=Pan tro... 29 6.4
sp|Q9Y4D7|PLXD1_HUMAN Plexin-D1 OS=Homo sapiens GN=PLXND1 PE=1 SV=2 29 6.4
sp|O15031|PLXB2_HUMAN Plexin-B2 OS=Homo sapiens GN=PLXNB2 PE=1 SV=3 29 6.4

>sp|Q9V4A7|PLXB_DROME Plexin-B OS=Drosophila melanogaster GN=plexB
PE=1 SV=2
Length = 2051

Score = 36.2 bits (82), Expect = 0.052
Identities = 15/50 (30%), Positives = 28/50 (56%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVV 118
P+CGW SL +CT+ + C T + G+G++ + + +P EK+ +
Sbjct: 551 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIP-EKIPI 599


>sp|P62932|FBX40_MOUSE F-box only protein 40 OS=Mus musculus
GN=Fbxo40 PE=2 SV=1
Length = 710

Score = 32.7 bits (73), Expect = 0.58
Identities = 13/41 (31%), Positives = 22/41 (53%)
Frame = -1

Query: 248 HCHPNVH*SISALVLRCRIVCAILGQERKLQR*IIMCPMKK 126
HCH V S+S LV+ C ++C K ++CP+++
Sbjct: 22 HCHVPVEPSVSCLVISCHLLCGATFHMCKESEHTLLCPLEQ 62


>sp|Q9JN46|AAM1_RHOSH Putative glycosidase (Fragment) OS=Rhodobacter
sphaeroides GN=aam1 PE=3 SV=1
Length = 678

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/38 (39%), Positives = 21/38 (55%)
Frame = -2

Query: 289 IPFSENPPLLWVVIIVIQMYTNQ*VPLFYAVGLYVLFW 176
I F+ENPP + I+ + Y L+YA+ VLFW
Sbjct: 413 IKFAENPPKKYEDIVNVHFYRGALPELWYALRDVVLFW 450


>sp|Q01347|VU9_HHV6U Protein U9 OS=Human herpesvirus 6A (strain
Uganda-1102) GN=U9 PE=4 SV=1
Length = 104

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/46 (32%), Positives = 22/46 (47%)
Frame = -3

Query: 258 GWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVV 121
G L++ C+ + K C LS+C C + V K D+H E V
Sbjct: 37 GVRGLNADCSYV-KSQCIKLSECECLYTFASDVCKEDFHNSEEMKV 81


>sp|Q646C0|T2R46_PANTR Taste receptor type 2 member 46 OS=Pan
troglodytes GN=TAS2R46 PE=3 SV=1
Length = 309

Score = 29.3 bits (64), Expect = 6.4
Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
Frame = -2

Query: 265 LLWVVIIVIQMYTNQ*VPLFYAVGLYVL---FWGRRESCKGRLSCAP*KSGSLFRYYLPL 95
LLWV+++ Y + P FY++ + + W L+ S S+F Y L +
Sbjct: 58 LLWVLLL--NWYATELNPAFYSIEVRITAYNLWAVINHFSNWLAT----SLSIF-YLLKI 110

Query: 94 IIFTDRVFLCAKMGYQSHVLAMIL 23
F++ +FLC K +S VL ++L
Sbjct: 111 ANFSNLIFLCLKRRVKSVVLVILL 134


>sp|Q9Y4D7|PLXD1_HUMAN Plexin-D1 OS=Homo sapiens GN=PLXND1 PE=1 SV=2
Length = 1925

Score = 29.3 bits (64), Expect = 6.4
Identities = 10/21 (47%), Positives = 14/21 (66%)
Frame = -3

Query: 264 YCGWLSLSSKCTLINKCPCST 202
YCGW +L ++CTL C S+
Sbjct: 565 YCGWCALETRCTLQQDCTNSS 585


>sp|O15031|PLXB2_HUMAN Plexin-B2 OS=Homo sapiens GN=PLXNB2 PE=1 SV=3
Length = 1838

Score = 29.3 bits (64), Expect = 6.4
Identities = 9/19 (47%), Positives = 12/19 (63%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCP 211
PYCGW + +CT +CP
Sbjct: 484 PYCGWCVVEGRCTRKAECP 502


tr_hit_id B4R2D2
Definition tr|B4R2D2|B4R2D2_DROSI GD24393 OS=Drosophila simulans
Align length 50
Score (bit) 36.2
E-value 0.85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921066|Adiantum capillus-veneris mRNA, clone:
YMU001_000145_B11.
(308 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4R2D2|B4R2D2_DROSI GD24393 OS=Drosophila simulans GN=GD24393... 36 0.85
tr|B4IL74|B4IL74_DROSE GM23238 OS=Drosophila sechellia GN=GM2323... 36 0.85
tr|B4MF19|B4MF19_DROVI GJ14688 OS=Drosophila virilis GN=GJ14688 ... 35 1.4
tr|B4L7G0|B4L7G0_DROMO GI14120 OS=Drosophila mojavensis GN=GI141... 35 1.4
tr|B3P9W3|B3P9W3_DROER GG16467 OS=Drosophila erecta GN=GG16467 P... 35 1.4
tr|B3MY28|B3MY28_DROAN GF19331 OS=Drosophila ananassae GN=GF1933... 35 1.4
tr|Q29CL9|Q29CL9_DROPS GA14409 OS=Drosophila pseudoobscura pseud... 35 1.9
tr|B4PVX7|B4PVX7_DROYA GE14532 OS=Drosophila yakuba GN=GE14532 P... 35 1.9
tr|B4H9N3|B4H9N3_DROPE GL18389 OS=Drosophila persimilis GN=GL183... 35 1.9
tr|B4NHI8|B4NHI8_DROWI GK13667 OS=Drosophila willistoni GN=GK136... 35 2.5
tr|Q7PSP2|Q7PSP2_ANOGA AGAP011139-PA (Fragment) OS=Anopheles gam... 34 4.2
tr|B4JZR9|B4JZR9_DROGR GH23993 OS=Drosophila grimshawi GN=GH2399... 33 5.5
tr|B7K5Z6|B7K5Z6_SYNP8 UDP-N-acetylglucosamine--N-acetylmuramyl-... 33 7.2
tr|B4BU55|B4BU55_9CHRO UDP-N-acetylglucosamine--N-acetylmuramyl-... 33 7.2
tr|B7PTP7|B7PTP7_IXOSC Plexin A, putative OS=Ixodes scapularis G... 33 7.2
tr|Q5DTZ7|Q5DTZ7_MOUSE MKIAA1195 protein (Fragment) OS=Mus muscu... 33 9.4
tr|Q3KN92|Q3KN92_MOUSE F-box protein 40 OS=Mus musculus GN=Fbxo4... 33 9.4

>tr|B4R2D2|B4R2D2_DROSI GD24393 OS=Drosophila simulans GN=GD24393
PE=4 SV=1
Length = 950

Score = 36.2 bits (82), Expect = 0.85
Identities = 15/50 (30%), Positives = 28/50 (56%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVV 118
P+CGW SL +CT+ + C T + G+G++ + + +P EK+ +
Sbjct: 457 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIP-EKIPI 505


>tr|B4IL74|B4IL74_DROSE GM23238 OS=Drosophila sechellia GN=GM23238
PE=4 SV=1
Length = 2004

Score = 36.2 bits (82), Expect = 0.85
Identities = 15/50 (30%), Positives = 28/50 (56%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVV 118
P+CGW SL +CT+ + C T + G+G++ + + +P EK+ +
Sbjct: 551 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIP-EKIPI 599


>tr|B4MF19|B4MF19_DROVI GJ14688 OS=Drosophila virilis GN=GJ14688
PE=4 SV=1
Length = 2069

Score = 35.4 bits (80), Expect = 1.4
Identities = 16/57 (28%), Positives = 28/57 (49%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVVFLDTICL 97
P+CGW SL +CT+ + C T + G+G++ + VP + + L + L
Sbjct: 578 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIDFESIVPDKIPITELTQVQL 634


>tr|B4L7G0|B4L7G0_DROMO GI14120 OS=Drosophila mojavensis GN=GI14120
PE=4 SV=1
Length = 2056

Score = 35.4 bits (80), Expect = 1.4
Identities = 16/57 (28%), Positives = 28/57 (49%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVVFLDTICL 97
P+CGW SL +CT+ + C T + G+G++ + VP + + L + L
Sbjct: 560 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIDFESIVPDKIPITELTRVQL 616


>tr|B3P9W3|B3P9W3_DROER GG16467 OS=Drosophila erecta GN=GG16467 PE=4
SV=1
Length = 2052

Score = 35.4 bits (80), Expect = 1.4
Identities = 13/44 (29%), Positives = 24/44 (54%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVP 136
P+CGW SL +CT+ + C T + G+G++ + + +P
Sbjct: 551 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIP 594


>tr|B3MY28|B3MY28_DROAN GF19331 OS=Drosophila ananassae GN=GF19331
PE=4 SV=1
Length = 2057

Score = 35.4 bits (80), Expect = 1.4
Identities = 15/57 (26%), Positives = 28/57 (49%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVPHEKVVVFLDTICL 97
P+CGW SL +CT+ + C T + G+G++ + +P + + L + L
Sbjct: 555 PFCGWCSLEKRCTIRSTCQRDTSASRWLSLGSGQQCIDFESIIPDKVPITELTLLHL 611


>tr|Q29CL9|Q29CL9_DROPS GA14409 OS=Drosophila pseudoobscura
pseudoobscura GN=GA14409 PE=4 SV=1
Length = 2069

Score = 35.0 bits (79), Expect = 1.9
Identities = 14/44 (31%), Positives = 23/44 (52%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVP 136
P+CGW SL +CT+ + C T + G+G++ + VP
Sbjct: 562 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIDFESIVP 605


>tr|B4PVX7|B4PVX7_DROYA GE14532 OS=Drosophila yakuba GN=GE14532 PE=4
SV=1
Length = 2052

Score = 35.0 bits (79), Expect = 1.9
Identities = 13/44 (29%), Positives = 24/44 (54%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVP 136
P+CGW SL +CT+ + C T + G+G++ + + +P
Sbjct: 551 PFCGWCSLERRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIP 594


>tr|B4H9N3|B4H9N3_DROPE GL18389 OS=Drosophila persimilis GN=GL18389
PE=4 SV=1
Length = 2069

Score = 35.0 bits (79), Expect = 1.9
Identities = 14/44 (31%), Positives = 23/44 (52%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVP 136
P+CGW SL +CT+ + C T + G+G++ + VP
Sbjct: 562 PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIDFESIVP 605


>tr|B4NHI8|B4NHI8_DROWI GK13667 OS=Drosophila willistoni GN=GK13667
PE=4 SV=1
Length = 2061

Score = 34.7 bits (78), Expect = 2.5
Identities = 13/44 (29%), Positives = 23/44 (52%)
Frame = -3

Query: 267 PYCGWLSLSSKCTLINKCPCSTLSDCMCYFGAGEKVAKVDYHVP 136
P+CGW SL +CT+ + C T + G+G++ + +P
Sbjct: 559 PFCGWCSLEKRCTVRSACQRDTSASRWLSLGSGQQCIDFESIIP 602