BP921125
Clone id YMU001_000146_A08
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000146_A08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATCGTGTATGAACACAACTTGTTCACAATGCTGCGGAAGTACGAATGTATCCCACACATC
TATCCACACCCGCCTAGAGTTCACTTGAATCAATCCACTCTTGTCTTTGTGCATATTTGC
ATTAGGGCCGCTGGTAATAACTTTGAACCACTTGACATCAAAGATAAACATATCATCAAA
CTTTCTAAAGCTAATCTTCAAGATTTCTTGGATGTAGCCAAAGTATTCAAGCTGGCTAGT
CTCTGTATTCTCATCCCTGGCACTACTCCTACTTTCTTGGACGAAGCTTGCCCTAACAAC
ACTGTCGAAAGTGACCCCTTGTTTGTCGATCCGTTGTACTCTAAAGTGCTTCCCATGCGA
CCACAAAGCTCCATTTTTGTAATACTGCAGCCAAAAAATTAAAACAAACTAAAAGTTATT
AAAGGAAACTAATTTGCATGTGGAGCTCAAACAGGAAGTTCTGAAATGTACAGCCAATCA
CAACCCCTTGACATCTCCTCTTCCTCTTCA
■■Homology search results ■■ -
sp_hit_id O60469
Definition sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens
Align length 52
Score (bit) 31.6
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921125|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_A08.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Ho... 32 2.2
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase D... 32 2.3

>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo
sapiens GN=DSCAM PE=2 SV=2
Length = 2012

Score = 31.6 bits (70), Expect = 2.2
Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 6/52 (11%)
Frame = -1

Query: 390 LQYYKNGALWSHGKHFRVQRIDKQGVTFDSVVRAS------FVQESRSSARD 253
L +Y+NG + + GK+ R+ I+ + + D +V++ FV++ + SA+D
Sbjct: 345 LSWYRNGEILNPGKNVRITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQD 396


>sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase
DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895
PE=3 SV=1
Length = 1634

Score = 31.6 bits (70), Expect = 2.3
Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
Frame = -2

Query: 356 MGSTLEYNGSTNKGSLSTVLLGQ---ASSKKVGVVPGMRIQRLASLNTLATSKKS*RLAL 186
+G+ YN + N +T+ +GQ A+S + P + + ++SL TL +S R
Sbjct: 518 LGNLSTYNNNNNNTINNTISIGQSKSANSSPNKISPSVSLVGVSSLTTLPSSTPEERELH 577

Query: 185 ESLMICLSL 159
+ L ICL L
Sbjct: 578 KLLPICLDL 586


tr_hit_id A5CAB0
Definition tr|A5CAB0|A5CAB0_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 118
Score (bit) 48.5
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921125|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_A08.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5CAB0|A5CAB0_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5BH99|A5BH99_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5BI79|A5BI79_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5ASG5|A5ASG5_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A3BXB2|A3BXB2_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.003
tr|Q0ZCF0|Q0ZCF0_POPTR Transposase OS=Populus trichocarpa PE=2 SV=1 44 0.004
tr|Q0E0J8|Q0E0J8_ORYSJ Os02g0543900 protein (Fragment) OS=Oryza ... 44 0.005
tr|B7EVA8|B7EVA8_ORYSJ cDNA clone:J033150C13, full insert sequen... 44 0.005
tr|A7QDS2|A7QDS2_VITVI Chromosome chr15 scaffold_82, whole genom... 44 0.005
tr|A5B4X7|A5B4X7_VITVI Putative uncharacterized protein OS=Vitis... 44 0.005
tr|A5AFG1|A5AFG1_VITVI Putative uncharacterized protein OS=Vitis... 44 0.005
tr|A5C4Y8|A5C4Y8_VITVI Putative uncharacterized protein OS=Vitis... 43 0.008
tr|Q2QP23|Q2QP23_ORYSJ Os12g0544600 protein OS=Oryza sativa subs... 43 0.010
tr|Q0JIZ7|Q0JIZ7_ORYSJ Os01g0768600 protein (Fragment) OS=Oryza ... 43 0.010
tr|Q7XES8|Q7XES8_ORYSJ Transposon protein, putative, CACTA, En/S... 42 0.013
tr|A5AQY2|A5AQY2_VITVI Putative uncharacterized protein OS=Vitis... 42 0.013
tr|A3C4N0|A3C4N0_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.013
tr|Q9AV04|Q9AV04_ORYSJ Os10g0477300 protein OS=Oryza sativa subs... 41 0.039
tr|Q75LW3|Q75LW3_ORYSJ Transposon protein, putative, CACTA, En/S... 41 0.039
tr|Q2QRF1|Q2QRF1_ORYSJ Transposon protein, putative, CACTA, En/S... 41 0.039
tr|Q0DQ80|Q0DQ80_ORYSJ Os03g0625100 protein OS=Oryza sativa subs... 41 0.039
tr|A5AGM8|A5AGM8_VITVI Putative uncharacterized protein OS=Vitis... 41 0.039
tr|Q8W331|Q8W331_ORYSJ Putative transposon protein OS=Oryza sati... 40 0.051
tr|Q10DX6|Q10DX6_ORYSJ Os03g0714800 protein OS=Oryza sativa subs... 40 0.051
tr|A3AM29|A3AM29_ORYSJ Putative uncharacterized protein OS=Oryza... 40 0.051
tr|Q2R3Z3|Q2R3Z3_ORYSJ Transposon protein, putative, CACTA, En/S... 40 0.087
tr|Q53K90|Q53K90_ORYSJ Transposon protein, putative, CACTA, En/S... 39 0.11
tr|A3BX07|A3BX07_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.11
tr|Q8S6M8|Q8S6M8_ORYSJ Putative TNP2-like transposon protein OS=... 38 0.33
tr|Q7G3C6|Q7G3C6_ORYSJ Transposon protein, putative, CACTA, En/S... 38 0.33

>tr|A5CAB0|A5CAB0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024839 PE=4 SV=1
Length = 843

Score = 48.5 bits (114), Expect = 2e-04
Identities = 32/118 (27%), Positives = 58/118 (49%)
Frame = -1

Query: 354 GKHFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQEILKISFRKFD 175
G F + K+ T +S V + S +SARD+N + Y+G I +++++ + +
Sbjct: 238 GSDFTQENEKKEKKTQNSGVVVTVEVSSFASARDKNPIPGHVSYYGVITDVIELHYLGGN 297

Query: 174 DMFIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWIDVWDTFVLPQHCEQVVFIHD 1
+ +F W+ VI SG + KD+ G +N R I + FVL +QV ++ +
Sbjct: 298 RVILFKCDWWDVINSG--RGIKKDEYGFTCLNFERT-ICTDEPFVLASQAKQVFYVQN 352


>tr|A5BH99|A5BH99_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027273 PE=4 SV=1
Length = 1163

Score = 47.4 bits (111), Expect = 4e-04
Identities = 32/120 (26%), Positives = 60/120 (50%)
Frame = -1

Query: 360 SHGKHFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQEILKISFRK 181
S G +F + K+ T +S V + S +SARD+N + Y+G + +++++ +
Sbjct: 554 SRGPNFTQESEKKEKKTQNSGVVVTAKVLSFASARDKNPIPGHVSYYGVLTDVIELHYLG 613

Query: 180 FDDMFIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWIDVWDTFVLPQHCEQVVFIHD 1
+ + +F W+ VI SG + KD+ G +N R I + FVL +QV ++ +
Sbjct: 614 GNRVILFKCDWWDVINSG--RGIKKDEYGFTCLNFERT-ICXDEPFVLASQAKQVFYVQN 670


>tr|A5BI79|A5BI79_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016465 PE=4 SV=1
Length = 593

Score = 45.4 bits (106), Expect = 0.002
Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 3/132 (2%)
Frame = -1

Query: 387 QYYKNGALWSHGKHFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQ 208
+YY NG L+ +H +R G+ DS+ RSS++DE++ + Y+G +
Sbjct: 247 KYYINGFLFITKEHESSRRYQNSGICIDSMTTF------RSSSKDESSIDEAIIYYGVFK 300

Query: 207 EILKISFRKFDDMFIFDVKWFKVITSGPNANMHKDKSGLIQVN-SRRVWIDVWD--TFVL 37
+I+ + + + + +F W K +S VN S + D+ D F+L
Sbjct: 301 DIIXLEYHEGYKLVLFKCDWVK-------------ESNXRMVNLSNMIRFDLLDDEPFIL 347

Query: 36 PQHCEQVVFIHD 1
+H QV++ D
Sbjct: 348 AKHARQVLYSKD 359


>tr|A5ASG5|A5ASG5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013246 PE=4 SV=1
Length = 1277

Score = 45.1 bits (105), Expect = 0.002
Identities = 31/116 (26%), Positives = 57/116 (49%)
Frame = -1

Query: 348 HFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQEILKISFRKFDDM 169
H R ++ K+ VV A S +SARD+N + Y+G + +++++ + + +
Sbjct: 656 HKRTRKRKKKTQNSGVVVTAEV--SSFASARDKNXIPGHVSYYGVLTDVIELHYLGGNRV 713

Query: 168 FIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWIDVWDTFVLPQHCEQVVFIHD 1
+F W+ VI SG + KD+ G +N R I + FVL +QV ++ +
Sbjct: 714 ILFKCDWWDVINSG--RGIKKDEYGFTCLNFERT-ICTDEPFVLASQAKQVFYVQN 766


>tr|A3BXB2|A3BXB2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_027684 PE=4 SV=1
Length = 507

Score = 44.7 bits (104), Expect = 0.003
Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 2/88 (2%)
Frame = -1

Query: 264 SARDENTETSQLEYFGYIQEILKISFRKF--DDMFIFDVKWFKVITSGPNANMHKDKSGL 91
S+ DEN T LEY+G I++I+K+S+ ++ +FD +WF SG + H +GL
Sbjct: 297 SSVDENNNT--LEYYGVIEDIIKVSWEGSLQLELVLFDCRWFDPTPSGVRRSEH---TGL 351

Query: 90 IQVNSRRVWIDVWDTFVLPQHCEQVVFI 7
++V + + +D FV+ +QV ++
Sbjct: 352 VEV-KQTSRLSNFDPFVMANQVKQVYYV 378


>tr|Q0ZCF0|Q0ZCF0_POPTR Transposase OS=Populus trichocarpa PE=2 SV=1
Length = 1450

Score = 44.3 bits (103), Expect = 0.004
Identities = 19/78 (24%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
Frame = -1

Query: 234 QLEYFGYIQEILKISFRKFDD-MFIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWID 58
+++Y+G ++E++++ + + +F+F W++ G + H GL+++NS+ +
Sbjct: 869 EVDYYGRLEEVVELQYHSEQNRVFLFKCYWYETTDRGIRVDPHY---GLVEINSKARLSN 925

Query: 57 VWDTFVLPQHCEQVVFIH 4
V D FV + C+QV + +
Sbjct: 926 VNDVFVFAKQCQQVYYTY 943


>tr|Q0E0J8|Q0E0J8_ORYSJ Os02g0543900 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os02g0543900 PE=4 SV=1
Length = 387

Score = 43.9 bits (102), Expect = 0.005
Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 4/124 (3%)
Frame = -1

Query: 360 SHGKHFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQEILKISFRK 181
+ G FR +R+D GVT +S V + + S + A D N + Y+G I +I+++++
Sbjct: 187 TRGFRFRPKRLD--GVTQNSGVVLTAKKSSYTKASDANPILGDVTYYGRIIDIIELNYSG 244

Query: 180 FDDMFIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWID----VWDTFVLPQHCEQVV 13
+ +F +W VI+ + KDK VN + + F+LP +QV
Sbjct: 245 KFSVVLFKCEWVDVIS---GKGIKKDKYDYTLVNFSHLIHTGEKIEHEPFILPNQADQVF 301

Query: 12 FIHD 1
++ D
Sbjct: 302 YVDD 305


>tr|B7EVA8|B7EVA8_ORYSJ cDNA clone:J033150C13, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 360

Score = 43.9 bits (102), Expect = 0.005
Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 4/124 (3%)
Frame = -1

Query: 360 SHGKHFRVQRIDKQGVTFDSVVRASFVQESRSSARDENTETSQLEYFGYIQEILKISFRK 181
+ G FR +R+D GVT +S V + + S + A D N + Y+G I +I+++++
Sbjct: 160 TRGFRFRPKRLD--GVTQNSGVVLTAKKSSYTKASDANPILGDVTYYGRIIDIIELNYSG 217

Query: 180 FDDMFIFDVKWFKVITSGPNANMHKDKSGLIQVNSRRVWID----VWDTFVLPQHCEQVV 13
+ +F +W VI+ + KDK VN + + F+LP +QV
Sbjct: 218 KFSVVLFKCEWVDVIS---GKGIKKDKYDYTLVNFSHLIHTGEKIEHEPFILPNQADQVF 274

Query: 12 FIHD 1
++ D
Sbjct: 275 YVDD 278


>tr|A7QDS2|A7QDS2_VITVI Chromosome chr15 scaffold_82, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036715001
PE=4 SV=1
Length = 168

Score = 43.9 bits (102), Expect = 0.005
Identities = 25/91 (27%), Positives = 49/91 (53%)
Frame = -1

Query: 273 SRSSARDENTETSQLEYFGYIQEILKISFRKFDDMFIFDVKWFKVITSGPNANMHKDKSG 94
S +SARD+N + Y+G + +++++ + + + +F W+ VI SG + KD+ G
Sbjct: 19 SFASARDKNPIPGHVSYYGVLIDVIELHYLGGNRIILFKCDWWDVINSG--RGIKKDEYG 76

Query: 93 LIQVNSRRVWIDVWDTFVLPQHCEQVVFIHD 1
+N +R I + FVL +QV ++ +
Sbjct: 77 FTCLNFKRT-ICTDEPFVLASQAKQVFYVQN 106


>tr|A5B4X7|A5B4X7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020317 PE=4 SV=1
Length = 1208

Score = 43.9 bits (102), Expect = 0.005
Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 1/95 (1%)
Frame = -1

Query: 282 VQESR-SSARDENTETSQLEYFGYIQEILKISFRKFDDMFIFDVKWFKVITSGPNANMHK 106
V+ SR +SARD+N + Y+G + +++++ + + + +F W+ VI SG + K
Sbjct: 618 VEVSRFASARDKNPIPGHVSYYGVLTDVIELHYLGGNRVILFKCDWWDVINSG--RGIKK 675

Query: 105 DKSGLIQVNSRRVWIDVWDTFVLPQHCEQVVFIHD 1
D+ G +N R I + FVL +QV ++ +
Sbjct: 676 DEYGFTCLNFERT-ICTDEPFVLASQAKQVFYVQN 709