BP921137
Clone id YMU001_000146_B09
Library
Length 113
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000146_B09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAAAAGGACTATCTCTAATTTTGAAGATGCCAATTTCCCCGACACTTGTGATGTGGG
ATATTGTGTTGGCGGCTTGTCGAAAATGGGGCAATCTGGAAGTGGGAAAAGTC
■■Homology search results ■■ -
sp_hit_id Q9FI80
Definition sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana
Align length 30
Score (bit) 39.3
E-value 0.006
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921137|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_B09.
(113 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 39 0.006
sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protei... 37 0.031
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 37 0.041
sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protei... 36 0.053
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 36 0.053
sp|Q9C9H9|PP114_ARATH Pentatricopeptide repeat-containing protei... 36 0.069
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 35 0.090
sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protei... 35 0.090
sp|Q9FRI5|PPR57_ARATH Pentatricopeptide repeat-containing protei... 35 0.12
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 35 0.12
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 34 0.20
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 34 0.20
sp|Q9FGR2|PP436_ARATH Pentatricopeptide repeat-containing protei... 34 0.26
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 34 0.26
sp|Q9CA73|PP119_ARATH Putative pentatricopeptide repeat-containi... 34 0.26
sp|Q9FK33|PP427_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9FNN7|PP371_ARATH Pentatricopeptide repeat-containing protei... 33 0.45
sp|Q9LJJ1|PP259_ARATH Putative pentatricopeptide repeat-containi... 33 0.45
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 33 0.59
sp|Q9LJI9|PP260_ARATH Pentatricopeptide repeat-containing protei... 33 0.59
sp|Q9SN85|PP267_ARATH Pentatricopeptide repeat-containing protei... 32 0.77
sp|Q9LR72|PPR7_ARATH Putative pentatricopeptide repeat-containin... 32 1.00
sp|Q9ZVG8|PPR60_ARATH Pentatricopeptide repeat-containing protei... 32 1.00
sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protei... 32 1.00
sp|P0C8Q8|PP394_ARATH Pentatricopeptide repeat-containing protei... 32 1.3

>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein
At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1
Length = 646

Score = 39.3 bits (90), Expect = 0.006
Identities = 17/30 (56%), Positives = 21/30 (70%)
Frame = +3

Query: 21 ILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
IL MPI P V+W +L ACR GN+E+GK
Sbjct: 434 ILNMPIKPDDVIWKALLGACRMQGNVEMGK 463


>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein
At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=2 SV=1
Length = 786

Score = 37.0 bits (84), Expect = 0.031
Identities = 16/31 (51%), Positives = 22/31 (70%)
Frame = +3

Query: 21 ILKMPISPTLVMWDIVLAACRKWGNLEVGKV 113
I KMPI P +V W +L+ACR N+++GKV
Sbjct: 574 IEKMPIEPDVVTWGSLLSACRVHKNIDLGKV 604


>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein
At2g42920, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-E75 PE=2 SV=1
Length = 559

Score = 36.6 bits (83), Expect = 0.041
Identities = 15/32 (46%), Positives = 22/32 (68%)
Frame = +3

Query: 15 SLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
+LI MP+ V+W +L+ACRK GN+E+ K
Sbjct: 416 ALIKNMPVEEDTVIWSSLLSACRKIGNVEMAK 447


>sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protein
At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1
Length = 643

Score = 36.2 bits (82), Expect = 0.053
Identities = 14/35 (40%), Positives = 21/35 (60%)
Frame = +3

Query: 6 KGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
K I +MPI PT ++W +L AC GN+E+ +
Sbjct: 425 KAYDFICQMPIPPTAIVWRTLLGACSSHGNIELAE 459


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 36.2 bits (82), Expect = 0.053
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = +3

Query: 6 KGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
+ + I MP P + W +L+ACR GNLE+GK
Sbjct: 526 EAMRFINGMPFPPDAIGWTTLLSACRNKGNLEIGK 560


>sp|Q9C9H9|PP114_ARATH Pentatricopeptide repeat-containing protein
At1g71420 OS=Arabidopsis thaliana GN=PCMP-H70 PE=2 SV=1
Length = 745

Score = 35.8 bits (81), Expect = 0.069
Identities = 14/32 (43%), Positives = 22/32 (68%)
Frame = +3

Query: 18 LILKMPISPTLVMWDIVLAACRKWGNLEVGKV 113
+I +MP+ P V+W +L +CRK GN +GK+
Sbjct: 525 VIKQMPMDPDAVVWIALLGSCRKHGNTRLGKL 556


>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein
At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1
Length = 722

Score = 35.4 bits (80), Expect = 0.090
Identities = 14/35 (40%), Positives = 24/35 (68%)
Frame = +3

Query: 6 KGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
+ L +I MP++ +V+W +++ACR G LE+GK
Sbjct: 499 EALEVIESMPVASNVVIWGSLMSACRIHGELELGK 533


>sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protein
At2g02980 OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2
Length = 603

Score = 35.4 bits (80), Expect = 0.090
Identities = 14/28 (50%), Positives = 21/28 (75%)
Frame = +3

Query: 27 KMPISPTLVMWDIVLAACRKWGNLEVGK 110
K+PISPT ++W I+LAAC NL++ +
Sbjct: 392 KLPISPTPMLWRILLAACSSHNNLDLAE 419


>sp|Q9FRI5|PPR57_ARATH Pentatricopeptide repeat-containing protein
At1g25360 OS=Arabidopsis thaliana GN=PCMP-H74 PE=2 SV=1
Length = 790

Score = 35.0 bits (79), Expect = 0.12
Identities = 13/31 (41%), Positives = 21/31 (67%)
Frame = +3

Query: 15 SLILKMPISPTLVMWDIVLAACRKWGNLEVG 107
S+I +P PT +W+ +L+ CR GN+E+G
Sbjct: 575 SVIESLPFKPTAEIWEALLSGCRVHGNMELG 605


>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein
At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1
Length = 842

Score = 35.0 bits (79), Expect = 0.12
Identities = 15/33 (45%), Positives = 23/33 (69%)
Frame = +3

Query: 6 KGLSLILKMPISPTLVMWDIVLAACRKWGNLEV 104
+ + LI MP+ P V+W+ +LAACR GN+E+
Sbjct: 625 EAVQLIEDMPMEPNDVIWNSLLAACRVQGNVEM 657


tr_hit_id A7R4G1
Definition tr|A7R4G1|A7R4G1_VITVI Chromosome undetermined scaffold_682, whole genome shotgun sequence OS=Vitis vinifera
Align length 36
Score (bit) 42.7
E-value 0.009
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921137|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_B09.
(113 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R4G1|A7R4G1_VITVI Chromosome undetermined scaffold_682, who... 43 0.009
tr|A7R352|A7R352_VITVI Chromosome undetermined scaffold_484, who... 43 0.009
tr|A5BVF2|A5BVF2_VITVI Putative uncharacterized protein OS=Vitis... 43 0.009
tr|B4FZF5|B4FZF5_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.059
tr|A7QW05|A7QW05_VITVI Chromosome chr2 scaffold_196, whole genom... 40 0.077
tr|A7PJW3|A7PJW3_VITVI Chromosome chr12 scaffold_18, whole genom... 40 0.077
tr|A5BZ17|A5BZ17_VITVI Putative uncharacterized protein OS=Vitis... 40 0.077
tr|A7QUT6|A7QUT6_VITVI Chromosome chr1 scaffold_180, whole genom... 39 0.10
tr|Q7XSV8|Q7XSV8_ORYSJ Os04g0110500 protein OS=Oryza sativa subs... 39 0.13
tr|Q25AD3|Q25AD3_ORYSA H0201G08.10 protein OS=Oryza sativa GN=H0... 39 0.13
tr|A7PT41|A7PT41_VITVI Chromosome chr8 scaffold_29, whole genome... 39 0.13
tr|A5B8S4|A5B8S4_VITVI Putative uncharacterized protein OS=Vitis... 39 0.13
tr|A2XPN5|A2XPN5_ORYSI Putative uncharacterized protein OS=Oryza... 39 0.13
tr|Q9FU66|Q9FU66_ORYSJ Putative uncharacterized protein P0013F10... 38 0.22
tr|Q0IZR0|Q0IZR0_ORYSJ Os09g0555400 protein OS=Oryza sativa subs... 38 0.22
tr|A7PRH4|A7PRH4_VITVI Chromosome chr14 scaffold_27, whole genom... 38 0.22
tr|A7PL13|A7PL13_VITVI Chromosome chr7 scaffold_20, whole genome... 38 0.22
tr|A7NWE8|A7NWE8_VITVI Chromosome chr5 scaffold_2, whole genome ... 38 0.22
tr|A5AZY0|A5AZY0_VITVI Putative uncharacterized protein OS=Vitis... 38 0.22
tr|A5AZT2|A5AZT2_VITVI Putative uncharacterized protein OS=Vitis... 38 0.22
tr|A2Z3X5|A2Z3X5_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.22
tr|A7QRN2|A7QRN2_VITVI Chromosome undetermined scaffold_151, who... 38 0.29
tr|A7QF00|A7QF00_VITVI Chromosome chr16 scaffold_86, whole genom... 37 0.38
tr|A7NWP9|A7NWP9_VITVI Chromosome chr5 scaffold_2, whole genome ... 37 0.38
tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome... 37 0.38
tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis... 37 0.38
tr|Q7XRD1|Q7XRD1_ORYSJ cDNA clone:J023003J09, full insert sequen... 37 0.50
tr|Q5ZAF9|Q5ZAF9_ORYSJ Pentatricopeptide (PPR) repeat-containing... 37 0.50
tr|Q2L3W7|Q2L3W7_WHEAT Selenium binding protein OS=Triticum aest... 37 0.50
tr|Q2L3D0|Q2L3D0_BRASY Selenium binding protein OS=Brachypodium ... 37 0.50

>tr|A7R4G1|A7R4G1_VITVI Chromosome undetermined scaffold_682, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004379001 PE=4 SV=1
Length = 573

Score = 42.7 bits (99), Expect = 0.009
Identities = 17/36 (47%), Positives = 26/36 (72%)
Frame = +3

Query: 3 GKGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
G+ + LI +MP+ P +V+W +L ACR GN+E+GK
Sbjct: 432 GEAIELIGRMPMKPDVVVWGALLGACRIHGNVEIGK 467


>tr|A7R352|A7R352_VITVI Chromosome undetermined scaffold_484, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00013464001 PE=4 SV=1
Length = 573

Score = 42.7 bits (99), Expect = 0.009
Identities = 17/36 (47%), Positives = 26/36 (72%)
Frame = +3

Query: 3 GKGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
G+ + LI +MP+ P +V+W +L ACR GN+E+GK
Sbjct: 432 GEAIELIGRMPMKPDVVVWGALLGACRIHGNVEIGK 467


>tr|A5BVF2|A5BVF2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_027628 PE=4 SV=1
Length = 688

Score = 42.7 bits (99), Expect = 0.009
Identities = 17/36 (47%), Positives = 26/36 (72%)
Frame = +3

Query: 3 GKGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
G+ + LI +MP+ P +V+W +L ACR GN+E+GK
Sbjct: 547 GEAIELIGRMPMKPDVVVWGALLGACRIHGNVEIGK 582


>tr|B4FZF5|B4FZF5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 570

Score = 40.0 bits (92), Expect = 0.059
Identities = 16/35 (45%), Positives = 25/35 (71%)
Frame = +3

Query: 6 KGLSLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
K + LI +MP+ P +V+W +L ACR GN+++GK
Sbjct: 432 KAVCLIKEMPMKPDVVVWGALLGACRIHGNVKIGK 466


>tr|A7QW05|A7QW05_VITVI Chromosome chr2 scaffold_196, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007631001
PE=4 SV=1
Length = 586

Score = 39.7 bits (91), Expect = 0.077
Identities = 17/31 (54%), Positives = 22/31 (70%)
Frame = +3

Query: 18 LILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
LIL MPI P V+W +L AC+ GN+E+GK
Sbjct: 373 LILNMPIKPDDVIWKALLGACKMHGNVEMGK 403


>tr|A7PJW3|A7PJW3_VITVI Chromosome chr12 scaffold_18, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018905001
PE=4 SV=1
Length = 497

Score = 39.7 bits (91), Expect = 0.077
Identities = 15/31 (48%), Positives = 23/31 (74%)
Frame = +3

Query: 18 LILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
LI MP++P ++W +L+ACRK GN+E+ K
Sbjct: 380 LIRNMPVNPDAIIWSSLLSACRKHGNVELAK 410


>tr|A5BZ17|A5BZ17_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029899 PE=4 SV=1
Length = 613

Score = 39.7 bits (91), Expect = 0.077
Identities = 17/31 (54%), Positives = 22/31 (70%)
Frame = +3

Query: 18 LILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
LIL MPI P V+W +L AC+ GN+E+GK
Sbjct: 395 LILNMPIKPDDVIWKALLGACKMHGNVEMGK 425


>tr|A7QUT6|A7QUT6_VITVI Chromosome chr1 scaffold_180, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00006973001
PE=4 SV=1
Length = 684

Score = 39.3 bits (90), Expect = 0.10
Identities = 16/32 (50%), Positives = 24/32 (75%)
Frame = +3

Query: 15 SLILKMPISPTLVMWDIVLAACRKWGNLEVGK 110
+LI MP++P V+W +LAAC+ GN+E+GK
Sbjct: 544 NLIEAMPVNPDAVVWGSLLAACKVHGNIEMGK 575


>tr|Q7XSV8|Q7XSV8_ORYSJ Os04g0110500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0027H06.17 PE=2 SV=2
Length = 531

Score = 38.9 bits (89), Expect = 0.13
Identities = 15/33 (45%), Positives = 23/33 (69%)
Frame = +3

Query: 15 SLILKMPISPTLVMWDIVLAACRKWGNLEVGKV 113
S+I MP+ P V+W L+AC+ GN+E+GK+
Sbjct: 410 SMIRTMPMDPNTVIWGAFLSACKVHGNMELGKI 442


>tr|Q25AD3|Q25AD3_ORYSA H0201G08.10 protein OS=Oryza sativa
GN=H0201G08.10 PE=4 SV=1
Length = 530

Score = 38.9 bits (89), Expect = 0.13
Identities = 15/33 (45%), Positives = 23/33 (69%)
Frame = +3

Query: 15 SLILKMPISPTLVMWDIVLAACRKWGNLEVGKV 113
S+I MP+ P V+W L+AC+ GN+E+GK+
Sbjct: 409 SMIRTMPMDPNTVIWGAFLSACKVHGNMELGKI 441