BP921148
Clone id YMU001_000146_C09
Library
Length 511
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000146_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGGAAGAATGGAGAAACGAAGACTACTACGTCAGAAACAGCGCAATGAAGGAGCAATAC
AAATAAACGCAGTCAGTATAACAGAAATGGATGATGACAAAGAAGAACCCATCATTGAAT
GCAAAGTAGGAACCAACCAAATCAAAGCGAGAGCACTATTGGATGCAGGAGCTCAAACTA
ACCTACTTTCACTCAGTTTGTATAGACAATTGACAAATGACACTAAATTACAAACTGCCA
AGCAAGAGTTAAAGAGTTACTCTGAGAATTCAATCAAAACTGTCGGATGCACAGTTTTAC
ATATACAGATTAACCGGTATGTGTATCCTCATATGTTTTACGTGGTTGAAGACCAAGCTA
CACAACATCCATTATTGCTAGGACAACCATGGTAGAAGCAATACAATGCAATGATTGACT
GGAGTTCTAAATCAGTGCTTATCAAATACGAAGGTGAACGTCAATCAGTTAAATTCACCA
AAGAAGTAGAGCCAACTCCAAAGGAAGAATC
■■Homology search results ■■ -
sp_hit_id P10394
Definition sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster
Align length 110
Score (bit) 38.9
E-value 0.014
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921148|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_C09.
(511 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 39 0.014
sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospor... 33 0.59
sp|Q9VK89|TRM1_DROME Probable N(2),N(2)-dimethylguanosine tRNA m... 31 3.9
sp|P12957|CALD1_CHICK Caldesmon OS=Gallus gallus GN=CALD1 PE=1 SV=2 30 6.6
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster ... 30 8.6
sp|Q05682|CALD1_HUMAN Caldesmon OS=Homo sapiens GN=CALD1 PE=1 SV=2 30 8.6

>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 38.9 bits (89), Expect = 0.014
Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 8/110 (7%)
Frame = +3

Query: 114 IECKVGTNQIKARALLDAGAQTNLLSLSLYR----QLTNDTKLQTAKQELKSYSENSIKT 281
I K G +K LLD GA ++L + + Q+TN +Q Q+ I++
Sbjct: 50 IHAKTG---VKLVFLLDTGADISILKENSDKFSNIQITNKINIQGIGQQ-------KIQS 99

Query: 282 VGCTVLHIQINRYVYPHMFYVVEDQATQHPL----LLGQPW*KQYNAMID 419
G T + IQ +YV PH F++V+ P+ ++G + K+YN ID
Sbjct: 100 RGQTFIEIQTGKYVIPHDFHLVD---KNFPIPCDGIIGIDFIKKYNCQID 146


>sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospora
crassa GN=ddi-1 PE=3 SV=2
Length = 439

Score = 33.5 bits (75), Expect = 0.59
Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 9/133 (6%)
Frame = +3

Query: 126 VGTNQIKARALLDAGAQTNLLSLSLYRQLTNDTKLQTAKQELKSYSENSIKTVGCT-VLH 302
V N K +AL+D+GAQ ++S + + +L + + + K +G
Sbjct: 208 VEVNGAKVKALVDSGAQATIMSPDI-AEACGIMRLVDKRYGGIAKGVGTAKIIGRVHTAP 266

Query: 303 IQINRYVYPHMFYVVEDQATQHPLLLGQPW*KQYNAMIDWSSKSVLIKYE-----GERQS 467
++I P F V+E + +LLG K+Y A ID + +++I+ E GE
Sbjct: 267 VKIGSLFLPCSFTVMEGKNVD--MLLGLDMLKRYQACIDLAKNALVIQGEEIPFLGEADI 324

Query: 468 VKFTKEV---EPT 497
K T+E EPT
Sbjct: 325 PKATEEALQDEPT 337


>sp|Q9VK89|TRM1_DROME Probable N(2),N(2)-dimethylguanosine tRNA
methyltransferase OS=Drosophila melanogaster GN=CG6388
PE=2 SV=1
Length = 578

Score = 30.8 bits (68), Expect = 3.9
Identities = 20/102 (19%), Positives = 45/102 (44%), Gaps = 4/102 (3%)
Frame = +3

Query: 36 KQRNEGAIQINAVSITEMDDDKEEPIIE----CKVGTNQIKARALLDAGAQTNLLSLSLY 203
K+R+E A++ + E +D+K P+ E + GT +L+A A T L S+
Sbjct: 59 KERSEKALKKQRKKVKEQEDEKTTPVPEDPPVYEAGTRYEDGLRILEALAATGLRSIRYA 118

Query: 204 RQLTNDTKLQTAKQELKSYSENSIKTVGCTVLHIQINRYVYP 329
+++ ++ S ++ ++ + H ++ + P
Sbjct: 119 QEIAGVRQIVA-----NDLSRQAVASINTNIRHNKVEELIEP 155


>sp|P12957|CALD1_CHICK Caldesmon OS=Gallus gallus GN=CALD1 PE=1 SV=2
Length = 771

Score = 30.0 bits (66), Expect = 6.6
Identities = 16/47 (34%), Positives = 26/47 (55%)
Frame = +3

Query: 12 EKRRLLRQKQRNEGAIQINAVSITEMDDDKEEPIIECKVGTNQIKAR 152
E+RR LR+++R E ++ +S DDD+EE E + Q + R
Sbjct: 5 ERRRELRRQKREEMRLEAERLSYQRNDDDEEEAARERRRRARQERLR 51


>sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster
GN=CLIP-190 PE=1 SV=1
Length = 1690

Score = 29.6 bits (65), Expect = 8.6
Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 14/103 (13%)
Frame = +3

Query: 12 EKRRLLRQKQRNE-GAIQINAVSITEMD-------DDKEEPIIECKVGTNQIKAR----- 152
E+ +L+R+ N IQ+ SI + +D ++ E +V +IKA+
Sbjct: 709 EQEKLVREMTENAINQIQLEKESIEQQLALKQNELEDFQKKQSESEVHLQEIKAQNTQKD 768

Query: 153 -ALLDAGAQTNLLSLSLYRQLTNDTKLQTAKQELKSYSENSIK 278
L+++G L L ++ KLQ A +ELK E IK
Sbjct: 769 FELVESGESLKKLQQQLEQKTLGHEKLQAALEELKKEKETIIK 811


>sp|Q05682|CALD1_HUMAN Caldesmon OS=Homo sapiens GN=CALD1 PE=1 SV=2
Length = 793

Score = 29.6 bits (65), Expect = 8.6
Identities = 15/47 (31%), Positives = 26/47 (55%)
Frame = +3

Query: 12 EKRRLLRQKQRNEGAIQINAVSITEMDDDKEEPIIECKVGTNQIKAR 152
E+RR LR+++R E ++ ++ DDD+EE E + Q + R
Sbjct: 5 ERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLR 51


tr_hit_id Q2AA34
Definition tr|Q2AA34|Q2AA34_ASPOF F7F22.15, related OS=Asparagus officinalis
Align length 130
Score (bit) 53.1
E-value 7.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921148|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_C09.
(511 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2AA34|Q2AA34_ASPOF F7F22.15, related OS=Asparagus officinali... 53 7e-06
tr|Q0ZCB7|Q0ZCB7_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 53 7e-06
tr|A5BM91|A5BM91_VITVI Putative uncharacterized protein OS=Vitis... 51 3e-05
tr|A5BST7|A5BST7_VITVI Putative uncharacterized protein OS=Vitis... 51 4e-05
tr|A5AQU2|A5AQU2_VITVI Putative uncharacterized protein OS=Vitis... 51 4e-05
tr|Q0ZCD5|Q0ZCD5_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 50 5e-05
tr|A5BYG3|A5BYG3_VITVI Putative uncharacterized protein OS=Vitis... 50 5e-05
tr|A7PFE2|A7PFE2_VITVI Chromosome chr11 scaffold_14, whole genom... 50 6e-05
tr|Q2AA50|Q2AA50_ASPOF Retrotransposon gag protein OS=Asparagus ... 49 1e-04
tr|A5BDC2|A5BDC2_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-04
tr|A5C9C9|A5C9C9_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5C706|A5C706_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5BJD2|A5BJD2_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5B1N0|A5B1N0_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5AHE6|A5AHE6_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5B8R3|A5B8R3_VITVI Putative uncharacterized protein OS=Vitis... 48 2e-04
tr|A5AXM0|A5AXM0_VITVI Putative uncharacterized protein OS=Vitis... 48 2e-04
tr|A5AS08|A5AS08_VITVI Putative uncharacterized protein OS=Vitis... 48 2e-04
tr|A5C6K1|A5C6K1_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A5BT64|A5BT64_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A5BI07|A5BI07_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A5C0U1|A5C0U1_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5BXE9|A5BXE9_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5AYI6|A5AYI6_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5AV42|A5AV42_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5AMM4|A5AMM4_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5AIX4|A5AIX4_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5C2B6|A5C2B6_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5BXX1|A5BXX1_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5BX31|A5BX31_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04

>tr|Q2AA34|Q2AA34_ASPOF F7F22.15, related OS=Asparagus officinalis
GN=20.t00032 PE=4 SV=1
Length = 481

Score = 53.1 bits (126), Expect = 7e-06
Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 11/130 (8%)
Frame = +3

Query: 96 DKEEPIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL----TNDTK--LQTAKQELKS 257
D PII C +G I +ALLD GA NLL S+Y+QL N TK LQ A + +K
Sbjct: 297 DLGSPIISCIIGNTHID-KALLDLGASVNLLPYSVYQQLGLGILNPTKCTLQLADRSVK- 354

Query: 258 YSENSIKTVGCTVLHIQINRYVYPHMFYVVEDQAT-----QHPLLLGQPW*KQYNAMIDW 422
+ + I++ +++P F V+E Q Q P++LG+P+ NA+I+
Sbjct: 355 -----VPMGELEDVLIKVGDFIFPVDFVVLETQPVFNPKGQTPVILGRPFLATSNALINC 409

Query: 423 SSKSVLIKYE 452
+ + + +E
Sbjct: 410 RTGQMKLSFE 419


>tr|Q0ZCB7|Q0ZCB7_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1
Length = 1332

Score = 53.1 bits (126), Expect = 7e-06
Identities = 37/110 (33%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
Frame = +3

Query: 108 PIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQLTNDTKLQTAKQELKSYSENSIKTVG 287
P I C +G ++IK RALLD GA NLL S+++ L N ++L+ A L ++ S+K
Sbjct: 184 PTISCFIGEHKIK-RALLDLGASVNLLPYSVFQSL-NLSELKPASVTL-LLADRSVKVPR 240

Query: 288 CTV--LHIQINRYVYPHMFYVVEDQATQ----HPLLLGQPW*KQYNAMID 419
+ + +Q+++++YP F V++ Q + P++LG P+ NA+I+
Sbjct: 241 GIIEDVLVQVDKFIYPVDFIVLDRQPVEACNSFPVILGHPFLATSNALIN 290


>tr|A5BM91|A5BM91_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036687 PE=4 SV=1
Length = 861

Score = 51.2 bits (121), Expect = 3e-05
Identities = 41/140 (29%), Positives = 73/140 (52%), Gaps = 7/140 (5%)
Frame = +3

Query: 108 PIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENSIKTV 284
P I +G Q++ +ALLD GA NLL S+Y++L + K + L S + V
Sbjct: 654 PTISVNIGGTQVE-KALLDLGASVNLLPYSVYKELGLGELKXTSITLSLADRSVKIPRGV 712

Query: 285 GCTVLHIQINRYVYPHMFYVVEDQ-----ATQHPLLLGQPW*KQYNAMIDWSSKSVLIKY 449
VL +Q++++ YP F V++ P++LG+P+ NA+I+ + S+L ++
Sbjct: 713 IEDVL-VQVDKFYYPVDFVVLDTDPIVKGINYVPIILGRPFLATSNAIINCRNGSMLDQF 771

Query: 450 EGE-RQSVKFTKEVEPTPKE 506
E +S++ +E P P +
Sbjct: 772 EESLNESLEVLEEGLPEPSD 791


>tr|A5BST7|A5BST7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_021833 PE=4 SV=1
Length = 1744

Score = 50.8 bits (120), Expect = 4e-05
Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 6/110 (5%)
Frame = +3

Query: 108 PIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENSIKTV 284
P I +G ++ +ALLD GA NLL S+Y+QL + KL L S K V
Sbjct: 546 PTISINIGGTHVE-KALLDLGASVNLLPYSMYKQLGLGELKLTAITLSLADRSVKIPKGV 604

Query: 285 GCTVLHIQINRYVYPHMFYVVED-----QATQHPLLLGQPW*KQYNAMID 419
VL +Q++++ YP F V+++ +A P++LG+P+ NA+I+
Sbjct: 605 IEDVL-VQVDKFYYPVDFVVIDNDPTIKEANYVPIILGRPFLATSNAIIN 653


>tr|A5AQU2|A5AQU2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018387 PE=4 SV=1
Length = 1554

Score = 50.8 bits (120), Expect = 4e-05
Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 8/146 (5%)
Frame = +3

Query: 96 DKEEPIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENS 272
D PII +G ++ +ALLD GA NLLS S+Y+QL + K T L S
Sbjct: 459 DPGSPIISVMIG-GKVVEKALLDLGASVNLLSYSIYKQLGLGELKPTTITLSLADRSVKI 517

Query: 273 IKTVGCTVLHIQINRYVYPHMFYVVE-----DQATQHPLLLGQPW*KQYNAMIDWSSKSV 437
+ V VL +Q++ + YP F V++ +A P++LG+P+ NA+I+ + +
Sbjct: 518 PRGVIEDVL-VQVDNFYYPVDFIVLDTDPTVKEANLVPIILGRPFLATSNAIINCRNGLM 576

Query: 438 LIKYEGER--QSVKFTKEVEPTPKEE 509
+ + ++ + + + TP+EE
Sbjct: 577 QLTFGNMTLDLNIFYMSKKQITPEEE 602


>tr|Q0ZCD5|Q0ZCD5_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1
Length = 619

Score = 50.4 bits (119), Expect = 5e-05
Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 5/109 (4%)
Frame = +3

Query: 108 PIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQLT-NDTKLQTAKQELKSYSENSIKTV 284
P I C +G ++I+ RALLD GA NLL S+++ L + K + L S K +
Sbjct: 285 PTISCFIGEHKIE-RALLDLGASVNLLPYSVFQSLNLGELKPTSVTLLLADRSVKVPKGI 343

Query: 285 GCTVLHIQINRYVYPHMFYVVEDQATQH----PLLLGQPW*KQYNAMID 419
VL +Q+++++YP F V++ Q + P++LG+P+ NA+I+
Sbjct: 344 VEDVL-VQVDKFIYPVDFVVLDTQPVEACNSIPVILGRPFLATSNALIN 391


>tr|A5BYG3|A5BYG3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025288 PE=4 SV=1
Length = 860

Score = 50.4 bits (119), Expect = 5e-05
Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 8/146 (5%)
Frame = +3

Query: 96 DKEEPIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENS 272
D P I +G ++ +ALLD GA NLL S+Y+QL + K T L S
Sbjct: 474 DPRSPTISVMIG-GKVVEKALLDLGASVNLLPYSVYKQLGLGELKPTTITLSLADRSVKI 532

Query: 273 IKTVGCTVLHIQINRYVYPHMFYVVE-----DQATQHPLLLGQPW*KQYNAMIDWSSKSV 437
+ V VL +Q++ + YP F V++ +A P++LG+P+ NA+I++ + +
Sbjct: 533 PRGVIEDVL-VQVDNFYYPVDFIVLDTDPTVKEANLVPIILGRPFLATSNAIINYRNGLM 591

Query: 438 LIKYEGER--QSVKFTKEVEPTPKEE 509
+ + ++ + + + TPKEE
Sbjct: 592 QLTFGNMTLDLNIFYMSKKQITPKEE 617


>tr|A7PFE2|A7PFE2_VITVI Chromosome chr11 scaffold_14, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017028001
PE=4 SV=1
Length = 755

Score = 50.1 bits (118), Expect = 6e-05
Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 8/146 (5%)
Frame = +3

Query: 96 DKEEPIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENS 272
D P I +G ++ +ALLD GA NLL S+Y+QL + K T L S
Sbjct: 460 DPGSPTISVMIG-GKVVEKALLDLGASVNLLPYSVYKQLGLGELKPTTITLSLADRSVKI 518

Query: 273 IKTVGCTVLHIQINRYVYPHMFYVVE-----DQATQHPLLLGQPW*KQYNAMIDWSSKSV 437
+ V VL +Q++ + YP F V++ +A P++LG+P+ NA+I+ + +
Sbjct: 519 PRGVIEDVL-VQVDNFYYPVNFIVLDTDPTVKEANLVPIILGRPFLATSNAIINCRNGLM 577

Query: 438 LIKYEGER--QSVKFTKEVEPTPKEE 509
+ + ++ +T + + TP+EE
Sbjct: 578 QLTFGNMTLDLNIFYTSKKQTTPEEE 603


>tr|Q2AA50|Q2AA50_ASPOF Retrotransposon gag protein OS=Asparagus
officinalis GN=19.t00014 PE=4 SV=1
Length = 1788

Score = 48.9 bits (115), Expect = 1e-04
Identities = 38/110 (34%), Positives = 57/110 (51%), Gaps = 6/110 (5%)
Frame = +3

Query: 108 PIIECKVGTNQIKARALLDAGAQTNLLSLSLYRQL-TNDTKLQTAKQELKSYSENSIKTV 284
P I C +G I +ALLD GA NLL S+Y+QL + K +L S K
Sbjct: 545 PTIPCVIGNTHID-KALLDLGASVNLLPYSVYQQLGVGELKPTRCTLQLADRSVKIPKGE 603

Query: 285 GCTVLHIQINRYVYPHMFYVVEDQ-----ATQHPLLLGQPW*KQYNAMID 419
VL I++ +++P F V+E Q +Q P++LG+P+ NA+I+
Sbjct: 604 VEDVL-IKVGEFIFPVDFIVLETQPVSNLKSQIPVILGRPFLATSNALIN 652


>tr|A5BDC2|A5BDC2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029416 PE=4 SV=1
Length = 286

Score = 48.9 bits (115), Expect = 1e-04
Identities = 33/126 (26%), Positives = 68/126 (53%), Gaps = 2/126 (1%)
Frame = +3

Query: 6 RMEKRRLLRQKQRNEGAIQINAVSITEMDDDKEEPIIECKVGTNQIKA-RALLDAGAQTN 182
+ +++RL+R I + S+T++D E+ ++ KVG + R L++ + N
Sbjct: 116 KRQRQRLVRVASVRGECISFSVHSLTKVDPTYEDALV-LKVGVDNFDVHRILINPRSSIN 174

Query: 183 LLSLSLYRQL-TNDTKLQTAKQELKSYSENSIKTVGCTVLHIQINRYVYPHMFYVVEDQA 359
LL +S YRQ+ + + L+ + L S+++ SI ++G VL +Q+ F VV+D +
Sbjct: 175 LLQMSAYRQMGYSSSTLENPGRILISFNKASIVSIGDVVLPVQVGPVTLNVYFLVVDDLS 234

Query: 360 TQHPLL 377
+ + ++
Sbjct: 235 SYNAIM 240