BP921155
Clone id YMU001_000146_D04
Library
Length 553
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000146_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGTAAGGCCACAGGCCTTCAAGGTGCAAGCTTAGGTCACAGGTGAATGCATCTTGGGAAA
GGCCTTCCCTTTGATACAGTTAAAACAGCTCAGAGCTTTCCCTGTGATAGGCAGCTTGGG
CTTGCACCATATCCCCTTCCCAGAACAACCTTGCAAGTAGCATCCCTCTCTCTCCTCTCT
TATGCAACTGCAACAATTCATACTCTTCCACAACCACCTCTTTGAAGCCATTCCTTCTCA
GCTTGCCAATTGCACTCAGCTCCAAAGCCTTACCCTCTCTGACAACACACTCTCGGAAAC
CTGCCAGAGCCTCTCTACTCCAAGAACATGATAGCCTCCATTCCTGCTAAGCTGGGCAAT
GGCTCCAGATTATTTTCTCTAGACTTTTCATTGAATGCTCTTAGAGGTGATATTCCTCAT
CAGATAAGTAGCATACCTTTCACATGCCCGGTGGATGCCCCTTTCGAGTTCAATGGCTTG
TTGAATTTACATCACAATTCACTCAGCAGGATTCTGNCCCTACCCTTGGTAATTACTGCT
TTGGACAGAAACT
■■Homology search results ■■ -
sp_hit_id Q9LHP4
Definition sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana
Align length 43
Score (bit) 38.5
E-value 2.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921155|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_D04.
(553 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidops... 39 2e-06
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil... 40 1e-05
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvian... 36 4e-05
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Sola... 36 4e-05
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 33 7e-04
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein ... 35 7e-04
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 33 0.002
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 41 0.004
sp|P58823|PGIP3_PHAVU Polygalacturonase inhibitor 3 OS=Phaseolus... 39 0.013
sp|P35334|PGIP1_PHAVU Polygalacturonase inhibitor 1 OS=Phaseolus... 39 0.013
sp|P58822|PGIP2_PHAVU Polygalacturonase inhibitor 2 OS=Phaseolus... 38 0.029
sp|Q6NSJ5|LRC8E_HUMAN Leucine-rich repeat-containing protein 8E ... 38 0.038
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 28 0.065
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyos... 30 0.087
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arab... 36 0.14
sp|Q8C0R9|YG015_MOUSE Leucine-rich repeat and death domain-conta... 35 0.25
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 34 0.42
sp|Q01513|CYAA_PODAN Adenylate cyclase OS=Podospora anserina PE=... 34 0.55
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase D... 33 0.71
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus... 33 0.71
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 33 0.80
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pong... 33 0.93
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus ... 33 0.93
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo... 33 0.93
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos ... 33 0.93
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis t... 30 1.0
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 33 1.2
sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g0868... 28 1.4
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 ... 32 1.6
sp|Q4R6F0|YG015_MACFA Leucine-rich repeat and death domain-conta... 32 2.1

>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis
thaliana GN=RCH2 PE=1 SV=1
Length = 1141

Score = 38.5 bits (88), Expect(2) = 2e-06
Identities = 17/43 (39%), Positives = 25/43 (58%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPF 441
L+ +++ IP ++GN S L +D SLN L G IP I + F
Sbjct: 305 LWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSF 347



Score = 32.7 bits (73), Expect(2) = 2e-06
Identities = 16/43 (37%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SL L +L+ ++ + IPS L NC++L L L +N+LS
Sbjct: 245 SLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLS 287



Score = 38.5 bits (88), Expect(2) = 8e-06
Identities = 21/47 (44%), Positives = 29/47 (61%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQS 310
L +L +L F + N L +IP LA+CT LQ+L LS N+L+ T S
Sbjct: 390 LGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPS 436



Score = 30.4 bits (67), Expect(2) = 8e-06
Identities = 15/41 (36%), Positives = 22/41 (53%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S ++ IP ++GN S L L N + G+IP I S+
Sbjct: 449 LISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSGIGSL 489



Score = 31.6 bits (70), Expect(2) = 0.003
Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 11/58 (18%)
Frame = +1

Query: 295 GNLPEPL-----------YSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
GNLP L Y+ + IP+ LGN S L L N+L G IP +I +
Sbjct: 240 GNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQL 297



Score = 28.5 bits (62), Expect(2) = 0.003
Identities = 13/41 (31%), Positives = 23/41 (56%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDN 286
P +S +L+ ILF N L +IP++L + L+ + + N
Sbjct: 171 PDISKCSKLKSLILFDNLLTGSIPTELGKLSGLEVIRIGGN 211



Score = 32.3 bits (72), Expect = 1.6
Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
Frame = +1

Query: 292 LGNLPEPLYSKNMIA-SIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L +L + + SKN+ + SIP LG S L LD N L G+IP ++ I
Sbjct: 561 LVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDI 609



Score = 31.6 bits (70), Expect = 2.7
Identities = 14/43 (32%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
S+ L L++F++ N +IP+ ++NC+ L L L N +S
Sbjct: 341 SIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQIS 383


>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil
GN=INRPK1 PE=2 SV=2
Length = 1109

Score = 36.6 bits (83), Expect(2) = 1e-05
Identities = 16/43 (37%), Positives = 28/43 (65%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL 292
P+L S +L++ +L +N+L ++PS L C+ L+ L L +N L
Sbjct: 446 PNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEENNL 488



Score = 31.6 bits (70), Expect(2) = 1e-05
Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 4/61 (6%)
Frame = +1

Query: 289 TLGNLPEP----LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPFTCPVD 456
+LGNL L S + SIP +LG+ +L L+ S N L+G +P ++S+ +D
Sbjct: 518 SLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELD 577

Query: 457 A 459
A
Sbjct: 578 A 578



Score = 40.0 bits (92), Expect(2) = 3e-05
Identities = 18/44 (40%), Positives = 28/44 (63%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P +S L L++ +L N F +IPSQL NC+ L+ + LS N+ +
Sbjct: 86 PEISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSFT 129



Score = 26.9 bits (58), Expect(2) = 3e-05
Identities = 15/42 (35%), Positives = 20/42 (47%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
L S + +IP LG L +L N+L G P + SIP
Sbjct: 123 LSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPESLLSIP 164



Score = 38.9 bits (89), Expect = 0.017
Identities = 20/49 (40%), Positives = 29/49 (59%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQS 310
P L SL++L+ L HN L +PS+L+NC +L L S N L+ + S
Sbjct: 541 PELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPS 589



Score = 32.0 bits (71), Expect = 2.1
Identities = 15/41 (36%), Positives = 23/41 (56%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L SIP++LGN S L +D S N+ G+IP + ++
Sbjct: 99 LSGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLGAL 139



Score = 31.6 bits (70), Expect = 2.7
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = +2

Query: 134 PFPEQPCK*HPSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
PFPE SL S+ L+ N L +IPS + N ++L +L L DN S
Sbjct: 155 PFPE-------SLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFS 201



Score = 30.8 bits (68), Expect = 4.6
Identities = 16/42 (38%), Positives = 25/42 (59%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
LS+ +L + HN L +IPS L + T+L L+L +N+ S
Sbjct: 567 LSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFS 608



Score = 30.4 bits (67), Expect = 6.0
Identities = 16/45 (35%), Positives = 23/45 (51%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSET 301
++ ++ +L L N +PS L N T LQ L L+DN L T
Sbjct: 183 NIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGT 227



Score = 30.4 bits (67), Expect = 6.0
Identities = 16/43 (37%), Positives = 23/43 (53%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL 292
PSL +L + L N L +IP +L + +L+ L LS N L
Sbjct: 517 PSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNIL 559


>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum
PE=1 SV=1
Length = 1207

Score = 36.2 bits (82), Expect(2) = 4e-05
Identities = 19/42 (45%), Positives = 26/42 (61%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L L L+ IL N L IP+ L+NCT+L ++LS+N LS
Sbjct: 495 LMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLS 536



Score = 30.4 bits (67), Expect(2) = 4e-05
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIP 417
L + ++ +IPA+LGN L LD + N L G IP
Sbjct: 554 LGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588



Score = 29.3 bits (64), Expect(2) = 0.083
Identities = 18/43 (41%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SLS+ QL L N+L +IPS L + ++L+ L L N LS
Sbjct: 446 SLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLS 488



Score = 25.8 bits (55), Expect(2) = 0.083
Identities = 12/37 (32%), Positives = 20/37 (54%)
Frame = +1

Query: 325 NMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
++ IPA L N ++L + S N L G+IP + +
Sbjct: 510 DLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRL 546


>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum
lycopersicum GN=CURL3 PE=1 SV=1
Length = 1207

Score = 36.2 bits (82), Expect(2) = 4e-05
Identities = 19/42 (45%), Positives = 26/42 (61%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L L L+ IL N L IP+ L+NCT+L ++LS+N LS
Sbjct: 495 LMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLS 536



Score = 30.4 bits (67), Expect(2) = 4e-05
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIP 417
L + ++ +IPA+LGN L LD + N L G IP
Sbjct: 554 LGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588



Score = 29.3 bits (64), Expect(2) = 0.083
Identities = 18/43 (41%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SLS+ QL L N+L +IPS L + ++L+ L L N LS
Sbjct: 446 SLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLS 488



Score = 25.8 bits (55), Expect(2) = 0.083
Identities = 12/37 (32%), Positives = 20/37 (54%)
Frame = +1

Query: 325 NMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
++ IPA L N ++L + S N L G+IP + +
Sbjct: 510 DLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRL 546


>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
OS=Arabidopsis thaliana GN=EXS PE=1 SV=1
Length = 1192

Score = 32.0 bits (71), Expect(2) = 7e-04
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Frame = +1

Query: 292 LGNLPEPLYSKNMI-ASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
LG+L + +KN + +PA LGN L +D S N L G++ ++S++
Sbjct: 675 LGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTM 723



Score = 30.4 bits (67), Expect(2) = 7e-04
Identities = 19/54 (35%), Positives = 26/54 (48%)
Frame = +2

Query: 134 PFPEQPCK*HPSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P PE+ L + L + L +NHL IP+ L+ T L L LS N L+
Sbjct: 595 PIPEE-------LGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALT 641



Score = 33.1 bits (74), Expect = 0.93
Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 3/104 (2%)
Frame = +1

Query: 136 LPRTTLQVASLSLLSYATATIHTLPQPPL*S-HSFSACQL--HSAPKPYPL*QHTLGNLP 306
+P++ ++ +LS+L+ +A + L P L + S + L +S P PL + L
Sbjct: 250 IPKSFGELHNLSILNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIPLLT 309

Query: 307 EPLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
+ S+P+ +G L SL + N G+IPH+I P
Sbjct: 310 FSAERNQLSGSLPSWMGKWKVLDSLLLANNRFSGEIPHEIEDCP 353



Score = 33.1 bits (74), Expect = 0.93
Identities = 16/33 (48%), Positives = 23/33 (69%)
Frame = +1

Query: 340 IPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
IP++LGN ++L LD S N L G+IP +I +P
Sbjct: 740 IPSELGNLTQLEYLDVSENLLSGEIPTKICGLP 772



Score = 32.3 bits (72), Expect = 1.6
Identities = 29/88 (32%), Positives = 40/88 (45%), Gaps = 6/88 (6%)
Frame = +2

Query: 50 ILGKAFPLIQLKQLRAFPVIGSLG----LHH--IPFPEQPCK*HPSLSSLMQLQQFILFH 211
+LG L K PV SLG L H + F + LS++ +L +
Sbjct: 674 LLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQ 733

Query: 212 NHLFEAIPSQLANCTQLQSLTLSDNTLS 295
N IPS+L N TQL+ L +S+N LS
Sbjct: 734 NKFTGEIPSELGNLTQLEYLDVSENLLS 761



Score = 30.0 bits (66), Expect = 7.9
Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
Frame = +1

Query: 298 NLPEPLYSKNMIAS-IPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
NL E S N + +PA++GN + L L S N L G+IP +I +
Sbjct: 449 NLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKL 495


>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein
kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1
Length = 1173

Score = 31.6 bits (70), Expect(2) = 7e-04
Identities = 16/42 (38%), Positives = 21/42 (50%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L L+ LQ F+ NHL +IP + L L LS N L+
Sbjct: 188 LGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLT 229



Score = 30.8 bits (68), Expect(2) = 7e-04
Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
Frame = +1

Query: 298 NLPEPLYSKNMI-ASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
NL + ++N++ IPA++GN S L L+ N L G IP ++ ++
Sbjct: 241 NLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNL 287



Score = 33.9 bits (76), Expect(2) = 0.001
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = +2

Query: 176 SLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
+L+ LQ +L N L IP+++ NC+ L L L DN L+
Sbjct: 238 NLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLT 277



Score = 27.3 bits (59), Expect(2) = 0.001
Identities = 14/38 (36%), Positives = 19/38 (50%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQI 426
LY + IPA+LGN +L +L N L IP +
Sbjct: 271 LYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSL 308



Score = 35.4 bits (80), Expect = 0.19
Identities = 19/41 (46%), Positives = 25/41 (60%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL 292
L +L+QLQ ++ N L +IPS L TQL L LS+N L
Sbjct: 284 LGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHL 324



Score = 33.5 bits (75), Expect = 0.71
Identities = 15/44 (34%), Positives = 25/44 (56%)
Frame = +2

Query: 182 MQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQSL 313
M L + NH IP + NC+ L++L+++DN L+ T + L
Sbjct: 431 MNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPL 474



Score = 33.1 bits (74), Expect = 0.93
Identities = 19/46 (41%), Positives = 28/46 (60%)
Frame = +2

Query: 173 SSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQS 310
SSL+QL+ L+ N L IP++L N QLQ+L + N L+ + S
Sbjct: 264 SSLVQLE---LYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPS 306



Score = 26.6 bits (57), Expect(2) = 1.0
Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTL-SDNTLSETCQSLSTPR 325
SL L QL L NHL I ++ L+ LTL S+N E QS++ R
Sbjct: 307 SLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLR 360



Score = 24.6 bits (52), Expect(2) = 1.0
Identities = 12/35 (34%), Positives = 18/35 (51%)
Frame = +1

Query: 340 IPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPFT 444
IP+ + N + L LD S N + G+IP + T
Sbjct: 400 IPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLT 434



Score = 32.0 bits (71), Expect = 2.1
Identities = 14/32 (43%), Positives = 20/32 (62%)
Frame = +1

Query: 340 IPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
IP GN + L SLD S N L G+IP ++++
Sbjct: 714 IPQSFGNMTHLVSLDLSSNNLTGEIPESLANL 745



Score = 30.0 bits (66), Expect = 7.9
Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Frame = +1

Query: 289 TLGNLPEPLYSKNMIAS-IPAKLGNGSRLFSLDFSLNALRGDIPHQISS 432
TL NL + S N + IP GN L SL + N L GDIP +I +
Sbjct: 214 TLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGN 262


>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1166

Score = 32.7 bits (73), Expect(2) = 0.002
Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 4/51 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISS 432
+GNL + L + ++ ++P +LGN L LD + N L GD+P +++S
Sbjct: 519 IGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDLPGELAS 569



Score = 27.7 bits (60), Expect(2) = 0.002
Identities = 13/36 (36%), Positives = 22/36 (61%)
Frame = +2

Query: 188 LQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L+ IL +N L +IP ++ CT + ++LS N L+
Sbjct: 477 LETLILNNNLLTGSIPESISRCTNMIWISLSSNRLT 512



Score = 31.2 bits (69), Expect = 3.5
Identities = 14/40 (35%), Positives = 23/40 (57%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISS 432
L S + IP+ +GN S+L L N+L G++P Q+ +
Sbjct: 506 LSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGN 545


>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1
SV=2
Length = 615

Score = 40.8 bits (94), Expect = 0.004
Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
LG LP LYS N+ +IP +LGN + L SLD LN L G IP + +
Sbjct: 88 LGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRL 139



Score = 33.9 bits (76), Expect = 0.55
Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
LGNL E LY N+ IP+ LG +L L + N+L G+IP ++++
Sbjct: 112 LGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAV 163


>sp|P58823|PGIP3_PHAVU Polygalacturonase inhibitor 3 OS=Phaseolus
vulgaris GN=PGIP3 PE=1 SV=1
Length = 342

Score = 39.3 bits (90), Expect = 0.013
Identities = 30/91 (32%), Positives = 39/91 (42%), Gaps = 29/91 (31%)
Frame = +1

Query: 253 HSAPKPYPL*QHTLGNLP-----------------EPLYSK------------NMIASIP 345
H+ PKPYP+ +L NLP P +K N+ +IP
Sbjct: 89 HNLPKPYPI-PSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP 147

Query: 346 AKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
L L +LDFS NAL G +P ISS+P
Sbjct: 148 DFLSQIKTLVTLDFSYNALSGTLPPSISSLP 178


>sp|P35334|PGIP1_PHAVU Polygalacturonase inhibitor 1 OS=Phaseolus
vulgaris GN=PGIP1 PE=1 SV=1
Length = 342

Score = 39.3 bits (90), Expect = 0.013
Identities = 30/91 (32%), Positives = 39/91 (42%), Gaps = 29/91 (31%)
Frame = +1

Query: 253 HSAPKPYPL*QHTLGNLP-----------------EPLYSK------------NMIASIP 345
H+ PKPYP+ +L NLP P +K N+ +IP
Sbjct: 89 HNLPKPYPI-PSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP 147

Query: 346 AKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
L L +LDFS NAL G +P ISS+P
Sbjct: 148 DFLSQIKTLVTLDFSYNALSGTLPPSISSLP 178


tr_hit_id A2Z8C9
Definition tr|A2Z8C9|A2Z8C9_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 53
Score (bit) 39.3
E-value 8.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921155|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_D04.
(553 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2Z8C9|A2Z8C9_ORYSI Putative uncharacterized protein OS=Oryza... 39 8e-07
tr|A7BSI0|A7BSI0_9GAMM Putative uncharacterized protein OS=Beggi... 41 4e-06
tr|A9TPI7|A9TPI7_PHYPA Predicted protein OS=Physcomitrella paten... 40 4e-06
tr|A5BY48|A5BY48_VITVI Putative uncharacterized protein OS=Vitis... 38 4e-06
tr|A7PCV2|A7PCV2_VITVI Chromosome chr17 scaffold_12, whole genom... 38 4e-06
tr|A9TE22|A9TE22_PHYPA CLL6 clavata1-like receptor S/T protein k... 37 5e-06
tr|B8LQX6|B8LQX6_PICSI Putative uncharacterized protein OS=Picea... 38 5e-06
tr|Q10MS0|Q10MS0_ORYSJ Leucine Rich Repeat family protein, expre... 37 5e-06
tr|A3AH11|A3AH11_ORYSJ Putative uncharacterized protein OS=Oryza... 37 5e-06
tr|Q5SMW4|Q5SMW4_ORYSJ Putative uncharacterized protein P0568D10... 44 7e-06
tr|A3B932|A3B932_ORYSJ Putative uncharacterized protein OS=Oryza... 44 7e-06
tr|A7PSA5|A7PSA5_VITVI Chromosome chr14 scaffold_27, whole genom... 38 8e-06
tr|A7QQL9|A7QQL9_VITVI Chromosome undetermined scaffold_143, who... 40 1e-05
tr|A9TVZ1|A9TVZ1_PHYPA Predicted protein (Fragment) OS=Physcomit... 40 1e-05
tr|Q65XS7|Q65XS7_ORYSJ Os05g0169600 protein OS=Oryza sativa subs... 36 1e-05
tr|Q6Z8S8|Q6Z8S8_ORYSJ Putative receptor protein kinase OS=Oryza... 37 1e-05
tr|A2YWK4|A2YWK4_ORYSI Putative uncharacterized protein OS=Oryza... 37 1e-05
tr|Q2R2D7|Q2R2D7_ORYSJ Os11g0569600 protein OS=Oryza sativa subs... 41 1e-05
tr|A3BUE6|A3BUE6_ORYSJ Putative uncharacterized protein OS=Oryza... 37 1e-05
tr|A3CCH3|A3CCH3_ORYSJ Putative uncharacterized protein OS=Oryza... 41 1e-05
tr|Q0J4S7|Q0J4S7_ORYSJ Os08g0493800 protein (Fragment) OS=Oryza ... 37 1e-05
tr|A7VM29|A7VM29_MARPO Receptor-like kinase (Fragment) OS=Marcha... 39 1e-05
tr|A7QI37|A7QI37_VITVI Chromosome chr17 scaffold_101, whole geno... 39 1e-05
tr|A5AU91|A5AU91_VITVI Putative uncharacterized protein OS=Vitis... 42 2e-05
tr|A7NXS5|A7NXS5_VITVI Chromosome chr5 scaffold_2, whole genome ... 42 2e-05
tr|Q0DZM7|Q0DZM7_ORYSJ Os02g0610000 protein OS=Oryza sativa subs... 39 2e-05
tr|Q6K6X6|Q6K6X6_ORYSJ Putative uncharacterized protein P0496E03... 39 2e-05
tr|A3A8Y6|A3A8Y6_ORYSJ Putative uncharacterized protein OS=Oryza... 39 2e-05
tr|A5C4B1|A5C4B1_VITVI Putative uncharacterized protein (Fragmen... 40 2e-05
tr|Q0J1P2|Q0J1P2_ORYSJ Os09g0423200 protein OS=Oryza sativa subs... 36 2e-05

>tr|A2Z8C9|A2Z8C9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_33968 PE=4 SV=1
Length = 999

Score = 39.3 bits (90), Expect(2) = 8e-07
Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 4/53 (7%)
Frame = +1

Query: 289 TLGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
++GNL + L+ N+ +IP ++GN + L SLD + N L+G++P ISS+
Sbjct: 452 SIGNLKQLTKLALFFNNLTGAIPPEIGNMTALQSLDVNTNHLQGELPATISSL 504



Score = 36.6 bits (83), Expect(2) = 8e-07
Identities = 19/44 (43%), Positives = 25/44 (56%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P LS +LQ LF N L +IP++L L+ L LSDN L+
Sbjct: 403 PELSKAKKLQFLYLFSNSLSGSIPAELGELENLEELDLSDNLLT 446



Score = 37.7 bits (86), Expect(2) = 2e-04
Identities = 19/42 (45%), Positives = 27/42 (64%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL 292
S+ +L QL + LF N+L AIP ++ N T LQSL ++ N L
Sbjct: 452 SIGNLKQLTKLALFFNNLTGAIPPEIGNMTALQSLDVNTNHL 493



Score = 30.0 bits (66), Expect(2) = 2e-04
Identities = 12/38 (31%), Positives = 21/38 (55%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQI 426
++ NM +IP LG G L + F+ N+ G++P +
Sbjct: 512 VFDNNMSGTIPPDLGKGIALQHVSFTNNSFSGELPRHL 549



Score = 34.3 bits (77), Expect = 4.6
Identities = 18/34 (52%), Positives = 22/34 (64%)
Frame = +1

Query: 337 SIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
SIP +LG+ S L L N L G IPHQ+SS+P
Sbjct: 134 SIPPQLGDLSGLVDLGLYNNNLVGAIPHQLSSLP 167


>tr|A7BSI0|A7BSI0_9GAMM Putative uncharacterized protein
OS=Beggiatoa sp. PS GN=BGP_1054 PE=4 SV=1
Length = 1308

Score = 38.5 bits (88), Expect(2) = 4e-06
Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+GNL + L S + SIP ++GN L+ LD S N L GDIP +S++
Sbjct: 445 IGNLTQLYNLELNSNQLSGSIPPEIGNLIELYYLDLSKNQLSGDIPSSLSNL 496



Score = 35.0 bits (79), Expect(2) = 4e-06
Identities = 18/44 (40%), Positives = 26/44 (59%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + +L QL L +N L +IP ++ + TQL +L LS N LS
Sbjct: 371 PEIGNLTQLVSLWLGNNQLSASIPPEIGHLTQLDTLILSGNQLS 414



Score = 37.0 bits (84), Expect(2) = 6e-06
Identities = 19/44 (43%), Positives = 26/44 (59%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + +L QL + L N L +IP ++ N TQL SL L +N LS
Sbjct: 347 PEIGNLTQLTELYLADNSLSGSIPPEIGNLTQLVSLWLGNNQLS 390



Score = 35.8 bits (81), Expect(2) = 6e-06
Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPEPLY----SKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+G+L + +Y S + SIP ++GN ++L++L+ + N L G IP +I ++
Sbjct: 421 IGHLTQLMYLYLDSNQLSGSIPPEIGNLTQLYNLELNSNQLSGSIPPEIGNL 472



Score = 39.7 bits (91), Expect(2) = 3e-05
Identities = 19/44 (43%), Positives = 28/44 (63%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + +L QL+ L+ N L +IP ++ N TQL L L+DN+LS
Sbjct: 251 PEIGNLTQLESLNLYENLLSGSIPPEIGNLTQLTRLYLADNSLS 294



Score = 30.8 bits (68), Expect(2) = 3e-05
Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+GNL + L + SIP ++GN ++L L S N L G IP +I ++
Sbjct: 301 IGNLTQLNLLSLMFNQLSGSIPPEIGNLTQLTYLSLSHNQLSGSIPPEIGNL 352



Score = 32.7 bits (73), Expect(2) = 0.001
Identities = 18/42 (42%), Positives = 24/42 (57%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
+ +L QL L NHL +IP ++ N TQL L L+ N LS
Sbjct: 181 IGNLNQLVHLDLACNHLTGSIPPEIGNLTQLTELILAFNQLS 222



Score = 32.3 bits (72), Expect(2) = 0.001
Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPE----PLYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+GNL + LY + SIP ++GN ++L L + N+L G IP +I ++
Sbjct: 253 IGNLTQLESLNLYENLLSGSIPPEIGNLTQLTRLYLADNSLSGSIPQEIGNL 304



Score = 34.7 bits (78), Expect(2) = 0.009
Identities = 18/44 (40%), Positives = 25/44 (56%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + +L QL + L N L +IP ++ N TQL L+L N LS
Sbjct: 275 PEIGNLTQLTRLYLADNSLSGSIPQEIGNLTQLNLLSLMFNQLS 318



Score = 27.3 bits (59), Expect(2) = 0.009
Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPEP----LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+GNL + L ++ SIP ++GN ++L SL N L IP +I +
Sbjct: 349 IGNLTQLTELYLADNSLSGSIPPEIGNLTQLVSLWLGNNQLSASIPPEIGHL 400



Score = 41.2 bits (95), Expect = 0.037
Identities = 20/44 (45%), Positives = 27/44 (61%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + +L QL L HN L +IP ++ N TQL L L+DN+LS
Sbjct: 323 PEIGNLTQLTYLSLSHNQLSGSIPPEIGNLTQLTELYLADNSLS 366



Score = 36.2 bits (82), Expect = 1.2
Identities = 16/40 (40%), Positives = 27/40 (67%)
Frame = +1

Query: 316 YSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
++ N+ SIP+K+GN ++L LD + N L G IP +I ++
Sbjct: 169 HNYNLNGSIPSKIGNLNQLVHLDLACNHLTGSIPPEIGNL 208



Score = 35.0 bits (79), Expect = 2.7
Identities = 16/36 (44%), Positives = 26/36 (72%)
Frame = +1

Query: 328 MIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+I SIP ++G+ ++L+ LD S N L GDIP +S++
Sbjct: 11 LIDSIPPEIGDLTQLYWLDLSGNQLSGDIPSSLSNL 46



Score = 35.0 bits (79), Expect = 2.7
Identities = 18/44 (40%), Positives = 24/44 (54%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + L QL L N L +IP ++ N TQL +L L+ N LS
Sbjct: 419 PEIGHLTQLMYLYLDSNQLSGSIPPEIGNLTQLYNLELNSNQLS 462



Score = 33.9 bits (76), Expect = 6.0
Identities = 18/42 (42%), Positives = 24/42 (57%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
+ +L QL L N L +IP ++ N TQL L+LS N LS
Sbjct: 301 IGNLTQLNLLSLMFNQLSGSIPPEIGNLTQLTYLSLSHNQLS 342



Score = 33.5 bits (75), Expect = 7.8
Identities = 18/44 (40%), Positives = 23/44 (52%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + L QL IL N L +IP ++ + TQL L L N LS
Sbjct: 395 PEIGHLTQLDTLILSGNQLSGSIPPEIGHLTQLMYLYLDSNQLS 438


>tr|A9TPI7|A9TPI7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_148633 PE=4 SV=1
Length = 1132

Score = 39.3 bits (90), Expect(2) = 4e-06
Identities = 20/46 (43%), Positives = 26/46 (56%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSET 301
PSL SL L++ +L N IP +L NCT L + L+ N LS T
Sbjct: 65 PSLGSLKSLEELVLSFNSFQGRIPPELGNCTSLVLMYLNQNRLSGT 110



Score = 34.3 bits (77), Expect(2) = 4e-06
Identities = 16/42 (38%), Positives = 25/42 (59%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
L + +IPA+LGN ++L + F+ N L GDIP ++ P
Sbjct: 102 LNQNRLSGTIPAELGNLTKLGDVMFAFNELEGDIPISFAACP 143



Score = 40.4 bits (93), Expect = 0.064
Identities = 19/43 (44%), Positives = 29/43 (67%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SL L +L+ F +++N + +IPSQ+ NCT LQS L+ N+ S
Sbjct: 309 SLGKLSKLKIFEVYNNSMSGSIPSQIFNCTSLQSFYLAQNSFS 351



Score = 31.6 bits (70), Expect(2) = 0.19
Identities = 17/41 (41%), Positives = 26/41 (63%)
Frame = +2

Query: 173 SSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
S+L L+ L N+L IP+ +++CT+L SL LS N +S
Sbjct: 552 SNLPNLESLNLSSNNLTGEIPTTVSSCTKLFSLDLSFNRIS 592



Score = 25.8 bits (55), Expect(2) = 0.19
Identities = 13/27 (48%), Positives = 16/27 (59%)
Frame = +1

Query: 337 SIPAKLGNGSRLFSLDFSLNALRGDIP 417
SIPA LGN ++LF L N + G P
Sbjct: 594 SIPASLGNLTKLFELRLKGNKISGMNP 620



Score = 35.0 bits (79), Expect = 2.7
Identities = 15/41 (36%), Positives = 24/41 (58%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S N+ IP + + ++LFSLD S N + G IP + ++
Sbjct: 562 LSSNNLTGEIPTTVSSCTKLFSLDLSFNRISGSIPASLGNL 602


>tr|A5BY48|A5BY48_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038730 PE=4 SV=1
Length = 1113

Score = 38.1 bits (87), Expect(2) = 4e-06
Identities = 14/43 (32%), Positives = 27/43 (62%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPF 441
L+ N++ +IP +LGN +L +D S+N++ G +P ++ F
Sbjct: 296 LWQNNLVGTIPPELGNCKQLVVIDISMNSISGRVPQTFGNLSF 338



Score = 35.4 bits (80), Expect(2) = 4e-06
Identities = 17/44 (38%), Positives = 27/44 (61%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
PSL L +LQ ++ L IP +L +CT+LQ++ L +N L+
Sbjct: 235 PSLGRLKKLQTLAIYTALLSGPIPPELGDCTELQNIYLYENALT 278



Score = 29.3 bits (64), Expect(2) = 0.25
Identities = 15/48 (31%), Positives = 25/48 (52%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQS 310
+ +L LQ+ L N + IP+Q+ NC L + L +N ++ T S
Sbjct: 332 TFGNLSFLQELQLSVNQISGQIPAQIGNCLGLTHIELDNNKITGTIPS 379



Score = 27.7 bits (60), Expect(2) = 0.25
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQI 426
L+ + +IP + N L ++DFS N+L G IP I
Sbjct: 392 LWQNMLEGNIPESISNCRSLEAVDFSENSLTGPIPKGI 429



Score = 37.7 bits (86), Expect = 0.41
Identities = 21/44 (47%), Positives = 26/44 (59%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
PSL SL L + IL N L IPS+L +C +L L LS N L+
Sbjct: 547 PSLGSLSSLTKLILRKNRLSGLIPSELNSCAKLVLLDLSSNDLT 590



Score = 29.6 bits (65), Expect(2) = 1.5
Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL-----SETCQSL 313
+ SSL L + +L +L +IP ++ L L LSDN L SE C L
Sbjct: 91 NFSSLTSLNKLVLTGTNLTGSIPKEIGVLQDLNYLDLSDNALTGEIPSEVCSLL 144



Score = 24.6 bits (52), Expect(2) = 1.5
Identities = 16/41 (39%), Positives = 21/41 (51%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S + SIP +LGN + L L N L G IP I ++
Sbjct: 151 LNSNWLEGSIPVQLGNLTSLTWLILYDNQLSGAIPSSIGNL 191


>tr|A7PCV2|A7PCV2_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016022001
PE=4 SV=1
Length = 1088

Score = 38.1 bits (87), Expect(2) = 4e-06
Identities = 14/43 (32%), Positives = 27/43 (62%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPF 441
L+ N++ +IP +LGN +L +D S+N++ G +P ++ F
Sbjct: 272 LWQNNLVGTIPPELGNCKQLVVIDISMNSISGRVPQTFGNLSF 314



Score = 35.4 bits (80), Expect(2) = 4e-06
Identities = 17/44 (38%), Positives = 27/44 (61%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
PSL L +LQ ++ L IP +L +CT+LQ++ L +N L+
Sbjct: 211 PSLGRLKKLQTLAIYTALLSGPIPPELGDCTELQNIYLYENALT 254



Score = 37.7 bits (86), Expect(2) = 0.089
Identities = 21/44 (47%), Positives = 26/44 (59%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
PSL SL L + IL N L IPS+L +C +L L LS N L+
Sbjct: 523 PSLGSLSSLTKLILRKNRLSGLIPSELNSCAKLVLLDLSSNDLT 566



Score = 20.8 bits (42), Expect(2) = 0.089
Identities = 10/25 (40%), Positives = 15/25 (60%)
Frame = +1

Query: 340 IPAKLGNGSRLFSLDFSLNALRGDI 414
IP++ + +L LD S N L GD+
Sbjct: 594 IPSEFTDLDKLGILDLSHNQLSGDL 618



Score = 29.3 bits (64), Expect(2) = 0.25
Identities = 15/48 (31%), Positives = 25/48 (52%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQS 310
+ +L LQ+ L N + IP+Q+ NC L + L +N ++ T S
Sbjct: 308 TFGNLSFLQELQLSVNQISGQIPAQIGNCLGLTHIELDNNKITGTIPS 355



Score = 27.7 bits (60), Expect(2) = 0.25
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQI 426
L+ + +IP + N L ++DFS N+L G IP I
Sbjct: 368 LWQNMLEGNIPESISNCRSLEAVDFSENSLTGPIPKGI 405



Score = 29.6 bits (65), Expect(2) = 1.5
Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL-----SETCQSL 313
+ SSL L + +L +L +IP ++ L L LSDN L SE C L
Sbjct: 67 NFSSLTSLNKLVLTGTNLTGSIPKEIGVLQDLNYLDLSDNALTGEIPSEVCSLL 120



Score = 24.6 bits (52), Expect(2) = 1.5
Identities = 16/41 (39%), Positives = 21/41 (51%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S + SIP +LGN + L L N L G IP I ++
Sbjct: 127 LNSNWLEGSIPVQLGNLTSLTWLILYDNQLSGAIPSSIGNL 167


>tr|A9TE22|A9TE22_PHYPA CLL6 clavata1-like receptor S/T protein
kinase protein OS=Physcomitrella patens subsp. patens
GN=CLL6 PE=4 SV=1
Length = 1144

Score = 37.4 bits (85), Expect(2) = 5e-06
Identities = 18/42 (42%), Positives = 24/42 (57%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
+YS N + SIP LGN + + +D S N L G IP I +P
Sbjct: 296 IYSNNFVGSIPESLGNLTSVREIDLSENFLTGGIPLSIFRLP 337



Score = 35.8 bits (81), Expect(2) = 5e-06
Identities = 21/46 (45%), Positives = 25/46 (54%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSET 301
P LS L L Q +L+ N L +IP +L N QLQ L L N L T
Sbjct: 235 PQLSLLTNLTQLVLWDNLLEGSIPPELGNLKQLQLLALYRNELRGT 280



Score = 31.2 bits (69), Expect(2) = 0.011
Identities = 15/42 (35%), Positives = 21/42 (50%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIP 438
L+ + SIP G +L LD SLN L G++P + P
Sbjct: 344 LFENRLSGSIPLAAGLAPKLAFLDLSLNNLSGNLPTSLQESP 385



Score = 30.4 bits (67), Expect(2) = 0.011
Identities = 13/44 (29%), Positives = 24/44 (54%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
P + L L + ++ N+ +IP L N T ++ + LS+N L+
Sbjct: 283 PEIGYLPLLDKLYIYSNNFVGSIPESLGNLTSVREIDLSENFLT 326



Score = 31.6 bits (70), Expect(2) = 0.088
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
Frame = +1

Query: 292 LGNLPEPLY----SKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
+G L + +Y ++ SIP ++GN S L LD S N+ G +P ++ +
Sbjct: 525 IGQLSQLVYLNVSCNSLTGSIPPEIGNCSLLQRLDLSYNSFTGSLPPELGDL 576



Score = 26.9 bits (58), Expect(2) = 0.088
Identities = 14/37 (37%), Positives = 21/37 (56%)
Frame = +2

Query: 176 SLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDN 286
SL L+Q L N IPS++ + LQ L+++DN
Sbjct: 479 SLRHLRQLELRSNLFSGIIPSEIGELSNLQVLSIADN 515



Score = 35.8 bits (81), Expect = 1.6
Identities = 18/41 (43%), Positives = 24/41 (58%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S + SIP ++G SRL LD S N L G+IP +I +
Sbjct: 104 LSSNRLTGSIPKEIGGLSRLIYLDLSTNNLTGNIPAEIGKL 144


>tr|B8LQX6|B8LQX6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 818

Score = 37.0 bits (84), Expect(2) = 5e-06
Identities = 19/42 (45%), Positives = 23/42 (54%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L L LQ+ L N L IP L NC+ L++L L DN LS
Sbjct: 322 LGLLQNLQKLYLHTNKLESTIPPSLGNCSSLENLFLGDNRLS 363



Score = 36.2 bits (82), Expect(2) = 5e-06
Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
Frame = +1

Query: 310 PLYSKNMIA-SIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPFT 444
P Y K I+ SIP+++GN S L LDF N ++G +P I +P +
Sbjct: 384 PEYVKGSISGSIPSEIGNCSSLVWLDFGNNRVQGSVPMSIFRLPLS 429



Score = 32.3 bits (72), Expect(2) = 0.003
Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFH-NHLFEAIPSQLANCTQLQSLTLSDNTL 292
PS+ SL++ + F N L IPS L NCT+L+ + S N L
Sbjct: 271 PSVLSLIRNLSLLYFEGNSLSGHIPSSLCNCTELRYIAFSHNNL 314



Score = 31.2 bits (69), Expect(2) = 0.003
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L++ + ++IP LGN S L +L N L G+IP Q S+
Sbjct: 333 LHTNKLESTIPPSLGNCSSLENLFLGDNRLSGNIPSQFGSL 373



Score = 37.7 bits (86), Expect = 0.41
Identities = 17/39 (43%), Positives = 29/39 (74%)
Frame = +2

Query: 179 LMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L++L+Q L +N+L +IP+ L+NCT LQ L++ N+L+
Sbjct: 229 LVKLEQLRLRNNNLSGSIPTSLSNCTSLQGLSIGYNSLT 267



Score = 35.4 bits (80), Expect = 2.0
Identities = 18/42 (42%), Positives = 27/42 (64%)
Frame = +2

Query: 170 LSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
L+SL +L+ + +N L IP+ + N TQLQ L LS+N +S
Sbjct: 542 LASLQELRVLSVAYNKLHGDIPASITNLTQLQVLDLSNNRIS 583



Score = 33.9 bits (76), Expect = 6.0
Identities = 18/41 (43%), Positives = 22/41 (53%)
Frame = +1

Query: 313 LYSKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
L S N+ IPA +GN S L L+ S N L G IP + I
Sbjct: 636 LSSNNLTGEIPASIGNLSTLRLLNLSRNQLEGKIPASLGQI 676


>tr|Q10MS0|Q10MS0_ORYSJ Leucine Rich Repeat family protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os03g18630 PE=4 SV=1
Length = 791

Score = 37.4 bits (85), Expect(2) = 5e-06
Identities = 20/43 (46%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SL L +L+ LF+N A+P QL C LQ+L LS N LS
Sbjct: 104 SLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLS 146



Score = 35.8 bits (81), Expect(2) = 5e-06
Identities = 14/35 (40%), Positives = 23/35 (65%)
Frame = +1

Query: 337 SIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPF 441
++PA L N +RL L+ + N L G +P ++S+PF
Sbjct: 148 AVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPF 182



Score = 33.5 bits (75), Expect = 7.8
Identities = 24/63 (38%), Positives = 30/63 (47%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQSLSTPRT**PPF 343
P L LQ L N L A+P+ LAN T+L L L+ N L+ S T PF
Sbjct: 127 PQLGGCALLQTLDLSGNFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSL----PF 182

Query: 344 LLS 352
L+S
Sbjct: 183 LVS 185


>tr|A3AH11|A3AH11_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_010083 PE=4 SV=1
Length = 791

Score = 37.4 bits (85), Expect(2) = 5e-06
Identities = 20/43 (46%), Positives = 25/43 (58%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLS 295
SL L +L+ LF+N A+P QL C LQ+L LS N LS
Sbjct: 104 SLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLS 146



Score = 35.8 bits (81), Expect(2) = 5e-06
Identities = 14/35 (40%), Positives = 23/35 (65%)
Frame = +1

Query: 337 SIPAKLGNGSRLFSLDFSLNALRGDIPHQISSIPF 441
++PA L N +RL L+ + N L G +P ++S+PF
Sbjct: 148 AVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPF 182



Score = 33.5 bits (75), Expect = 7.8
Identities = 24/63 (38%), Positives = 30/63 (47%)
Frame = +2

Query: 164 PSLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTLSETCQSLSTPRT**PPF 343
P L LQ L N L A+P+ LAN T+L L L+ N L+ S T PF
Sbjct: 127 PQLGGCALLQTLDLSGNFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSL----PF 182

Query: 344 LLS 352
L+S
Sbjct: 183 LVS 185


>tr|Q5SMW4|Q5SMW4_ORYSJ Putative uncharacterized protein P0568D10.9
OS=Oryza sativa subsp. japonica GN=P0568D10.9 PE=4 SV=1
Length = 1060

Score = 43.5 bits (101), Expect(2) = 7e-06
Identities = 21/42 (50%), Positives = 27/42 (64%)
Frame = +2

Query: 167 SLSSLMQLQQFILFHNHLFEAIPSQLANCTQLQSLTLSDNTL 292
+LS+L QL+ +L HNHL IP +A C LQ+L LS N L
Sbjct: 438 ALSNLTQLRWLVLHHNHLAGVIPPGIAQCVNLQNLDLSHNML 479



Score = 29.3 bits (64), Expect(2) = 7e-06
Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Frame = +1

Query: 319 SKNMIAS-IPAKLGNGSRLFSLDFSLNALRGDIPHQI 426
S N++ IPA +G + L L+ S N L GDIP QI
Sbjct: 499 SSNLLEGMIPATIGRMAMLQVLNLSSNRLSGDIPTQI 535



Score = 33.9 bits (76), Expect = 6.0
Identities = 14/39 (35%), Positives = 23/39 (58%)
Frame = +1

Query: 319 SKNMIASIPAKLGNGSRLFSLDFSLNALRGDIPHQISSI 435
S + +PA+LGN S L +LD S N G++P ++ +
Sbjct: 128 SNTFVGRVPAELGNLSSLNTLDLSRNLFTGEVPPELGDL 166