BP921176
Clone id YMU001_000146_F03
Library
Length 581
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000146_F03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACCTCCTACTGCTCCAAAATGAGCTTCTTGCAACACAACTGATTGCTCAAAATCTAGTAC
ACATCTCCTAATTACCTGATCAATCCCTTTTCTATATAAAGCTCCAACAATAACTAGAAA
AGGTCTACTAGTGAGAGCAAATTTCCTTCTTTGATTTGTTGTAAACTCAGTTGGCATGAT
ACCATCAGTTAAGAAAACAAGCATTTGATCATACCATGAATCAATAATGGAACTCTGAAT
TTCAAATAATTTTGCATTTGGTAACTGATCTTGAACTCCTGTCGGTAGTTCTCCTGTCTC
AATCCGACTCAGATAATCAGCTATTGCATGCTCTTTTCCAGATGTATGAACAATGATGAA
GTCAAAATCCTGTAACAGTAACATCCACCTTGCTAACCTACCTATAAGTAAGGGCTTTTT
GATAAGGTAAAGCAAAGCTTGATGATCAACATGGAATATGACTCTATTGCATAGGAGATA
ATGCCTGAATTTATTCAAAGCATAAACCATCCCTAAGGCTTCCCTCTCAGTTATTGCATA
ATTCTTCTCAACAAAGGTAAGTACCCTACTGGCATAGTACA
■■Homology search results ■■ -
sp_hit_id P04323
Definition sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster
Align length 104
Score (bit) 75.5
E-value 2.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921176|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_F03.
(581 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 75 2e-13
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 70 8e-12
sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa prot... 65 2e-10
sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa prot... 65 2e-10
sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa prot... 65 2e-10
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 60 6e-09
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from tra... 60 1e-08
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 57 7e-08
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 57 7e-08
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 57 9e-08
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched rin... 56 1e-07
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic ... 48 3e-05
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic ... 48 3e-05
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic ... 47 7e-05
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic ... 47 7e-05
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus... 47 9e-05
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing... 46 2e-04
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 46 2e-04
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic ... 45 3e-04
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic m... 44 6e-04
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf... 40 0.011
sp|Q71MB6|SO4C1_RAT Solute carrier organic anion transporter fam... 32 3.0
sp|Q8BGD4|SO4C1_MOUSE Solute carrier organic anion transporter f... 30 6.7

>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 75.5 bits (184), Expect = 2e-13
Identities = 43/104 (41%), Positives = 56/104 (53%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIGR 397
Y SR L E NY+ E+E L +V+A FRHYLL DHQ L +L + +
Sbjct: 533 YISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNSK 592

Query: 396 LARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTGVQDQ 265
L RW + L +FDF I + GKE+ +AD LSRI+ E Q Q
Sbjct: 593 LTRWRVKLSEFDFDIKYIKGKENCVADALSRIKLEETYLSEQTQ 636


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 70.1 bits (170), Expect = 8e-12
Identities = 40/98 (40%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYL--IKKPLLI 403
+ SR L E NY+ E+E L +V+A FRHYLL + + DHQ L +L +K+P
Sbjct: 532 FISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEP--G 589

Query: 402 GRLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGE 289
+L RW + L ++ F I + GKE+++AD LSRI+ E
Sbjct: 590 AKLERWRVRLSEYQFKIDYIKGKENSVADALSRIKIEE 627


>sp|Q9UR07|RTF23_SCHPO Retrotransposable element Tf2 155 kDa protein
type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1
Length = 1333

Score = 65.5 bits (158), Expect = 2e-10
Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 6/151 (3%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHV--DHQALLYLI--KKPL 409
Y S ++ + NY+++++E L ++ +L +RHYL F + DH+ L+ I +
Sbjct: 737 YYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEP 796

Query: 408 LIGRLARWMLLLQDFDFIIVHTSGKEHAIADYLSRI--ETGELPTGVQDQLPNAKLFEIQ 235
RLARW L LQDF+F I + G + IAD LSRI ET +P +D N+ F Q
Sbjct: 797 ENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVDETEPIPKDSED---NSINFVNQ 853

Query: 234 SSIIDSWYDQMLVFLTDGIMPTEFTTNQRRK 142
SI D + +Q++ T+ N+ ++
Sbjct: 854 ISITDDFKNQVVTEYTNDTKLLNLLNNEDKR 884


>sp|Q9C0R2|RTF22_SCHPO Retrotransposable element Tf2 155 kDa protein
type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1
Length = 1333

Score = 65.5 bits (158), Expect = 2e-10
Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 6/151 (3%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHV--DHQALLYLI--KKPL 409
Y S ++ + NY+++++E L ++ +L +RHYL F + DH+ L+ I +
Sbjct: 737 YYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEP 796

Query: 408 LIGRLARWMLLLQDFDFIIVHTSGKEHAIADYLSRI--ETGELPTGVQDQLPNAKLFEIQ 235
RLARW L LQDF+F I + G + IAD LSRI ET +P +D N+ F Q
Sbjct: 797 ENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVDETEPIPKDSED---NSINFVNQ 853

Query: 234 SSIIDSWYDQMLVFLTDGIMPTEFTTNQRRK 142
SI D + +Q++ T+ N+ ++
Sbjct: 854 ISITDDFKNQVVTEYTNDTKLLNLLNNEDKR 884


>sp|Q05654|RTF21_SCHPO Retrotransposable element Tf2 155 kDa protein
type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1
Length = 1333

Score = 65.5 bits (158), Expect = 2e-10
Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 6/151 (3%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHV--DHQALLYLI--KKPL 409
Y S ++ + NY+++++E L ++ +L +RHYL F + DH+ L+ I +
Sbjct: 737 YYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEP 796

Query: 408 LIGRLARWMLLLQDFDFIIVHTSGKEHAIADYLSRI--ETGELPTGVQDQLPNAKLFEIQ 235
RLARW L LQDF+F I + G + IAD LSRI ET +P +D N+ F Q
Sbjct: 797 ENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIVDETEPIPKDSED---NSINFVNQ 853

Query: 234 SSIIDSWYDQMLVFLTDGIMPTEFTTNQRRK 142
SI D + +Q++ T+ N+ ++
Sbjct: 854 ISITDDFKNQVVTEYTNDTKLLNLLNNEDKR 884


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 60.5 bits (145), Expect = 6e-09
Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 1/93 (1%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLL-CNRVIFHVDHQALLYLIKKPLLIG 400
Y SR L E+NYA E+E L ++++L+ R YL + + DHQ L + +
Sbjct: 463 YISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFALGNRNFNA 522

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRI 301
+L RW +++++ +++ GK + +AD LSRI
Sbjct: 523 KLKRWKARIEEYNCELIYKPGKSNVVADALSRI 555


>sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from
transposon 412 OS=Drosophila melanogaster GN=POL PE=4
SV=1
Length = 1237

Score = 59.7 bits (143), Expect = 1e-08
Identities = 34/97 (35%), Positives = 51/97 (52%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIGR 397
YASR T E N + TE+E + +A+ FR Y+ DH+ L YL +
Sbjct: 644 YASRAFTKGESNKSTTEQELAAIHWAIIHFRPYIYGKHFTVKTDHRPLTYLFSMVNPSSK 703

Query: 396 LARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGEL 286
L R L L++++F + + GK++ +AD LSRI EL
Sbjct: 704 LTRIRLELEEYNFTVEYLKGKDNHVADALSRITIKEL 740


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 57.0 bits (136), Expect = 7e-08
Identities = 32/91 (35%), Positives = 49/91 (53%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIGR 397
Y S+ L +KNY E E LG++ AL+ FR+ L DH +LL L K R
Sbjct: 944 YFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARR 1003

Query: 396 LARWMLLLQDFDFIIVHTSGKEHAIADYLSR 304
+ RW+ L +DF + + +G ++ +AD +SR
Sbjct: 1004 VQRWLDDLATYDFTLEYLAGPKNVVADAISR 1034


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 57.0 bits (136), Expect = 7e-08
Identities = 32/91 (35%), Positives = 49/91 (53%)
Frame = -3

Query: 576 YASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIGR 397
Y S+ L +KNY E E LG++ AL+ FR+ L DH +LL L K R
Sbjct: 918 YFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARR 977

Query: 396 LARWMLLLQDFDFIIVHTSGKEHAIADYLSR 304
+ RW+ L +DF + + +G ++ +AD +SR
Sbjct: 978 VQRWLDDLATYDFTLEYLAGPKNVVADAISR 1008


>sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from
transposon gypsy OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1035

Score = 56.6 bits (135), Expect = 9e-08
Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
Frame = -3

Query: 570 SRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVI-FHVDHQALLYLIKKPLLIGRL 394
SR L E+NYA ERE L +V+AL K +++L +R I DHQ L + + ++
Sbjct: 521 SRTLKQPEQNYATNERELLAIVWALGKLQNFLYGSREINIFTDHQPLTFAVADRNTNAKI 580

Query: 393 ARWMLLLQDFDFIIVHTSGKEHAIADYLSR 304
RW + + + + GKE+ +AD LSR
Sbjct: 581 KRWKSYIDQHNAKVFYKPGKENFVADALSR 610


tr_hit_id A5BM14
Definition tr|A5BM14|A5BM14_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 195
Score (bit) 134.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921176|Adiantum capillus-veneris mRNA, clone:
YMU001_000146_F03.
(581 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BM14|A5BM14_VITVI Putative uncharacterized protein OS=Vitis... 134 3e-30
tr|A5BRS7|A5BRS7_VITVI Putative uncharacterized protein OS=Vitis... 132 2e-29
tr|A5BXM1|A5BXM1_VITVI Putative uncharacterized protein OS=Vitis... 131 2e-29
tr|A5BAE8|A5BAE8_VITVI Putative uncharacterized protein OS=Vitis... 131 2e-29
tr|A5AEM1|A5AEM1_VITVI Putative uncharacterized protein OS=Vitis... 131 2e-29
tr|A5ATF8|A5ATF8_VITVI Putative uncharacterized protein OS=Vitis... 131 3e-29
tr|A5AZ01|A5AZ01_VITVI Putative uncharacterized protein OS=Vitis... 130 4e-29
tr|A5C647|A5C647_VITVI Putative uncharacterized protein OS=Vitis... 130 5e-29
tr|A5B147|A5B147_VITVI Putative uncharacterized protein OS=Vitis... 130 5e-29
tr|A5AFI3|A5AFI3_VITVI Putative uncharacterized protein OS=Vitis... 130 7e-29
tr|A5B504|A5B504_VITVI Putative uncharacterized protein OS=Vitis... 129 9e-29
tr|A5BJD2|A5BJD2_VITVI Putative uncharacterized protein OS=Vitis... 129 1e-28
tr|A5AH79|A5AH79_VITVI Putative uncharacterized protein OS=Vitis... 129 2e-28
tr|A7QJX4|A7QJX4_VITVI Chromosome undetermined scaffold_108, who... 128 2e-28
tr|A5BTX5|A5BTX5_VITVI Putative uncharacterized protein OS=Vitis... 128 2e-28
tr|A5B7Z2|A5B7Z2_VITVI Putative uncharacterized protein OS=Vitis... 128 3e-28
tr|A5AP17|A5AP17_VITVI Putative uncharacterized protein OS=Vitis... 128 3e-28
tr|Q9MAR5|Q9MAR5_ARATH F28H19.8 protein OS=Arabidopsis thaliana ... 127 3e-28
tr|Q0ZCB7|Q0ZCB7_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 127 3e-28
tr|A5C706|A5C706_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BXW5|A5BXW5_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BX55|A5BX55_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BVW2|A5BVW2_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BIH2|A5BIH2_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5BG10|A5BG10_VITVI Putative uncharacterized protein (Fragmen... 127 3e-28
tr|A5B5I2|A5B5I2_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|A5B1X1|A5B1X1_VITVI Putative uncharacterized protein OS=Vitis... 127 4e-28
tr|Q0ZCD0|Q0ZCD0_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 127 6e-28
tr|A5BVQ8|A5BVQ8_VITVI Putative uncharacterized protein OS=Vitis... 127 6e-28
tr|A5BP37|A5BP37_VITVI Putative uncharacterized protein OS=Vitis... 127 6e-28

>tr|A5BM14|A5BM14_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_012386 PE=4 SV=1
Length = 1397

Score = 134 bits (338), Expect = 3e-30
Identities = 73/195 (37%), Positives = 111/195 (56%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS++L ++NY T++E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 883 YYASKILNEAQRNYTTTKKELLAVVFALDKFRAYLVGSFIVVFTDHSALKYLLTKQDAKA 942

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L I+
Sbjct: 943 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPKESLMSIE--- 999

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ SWY Q+ +L G +P+E++ +R F + L++ DQ+IR+CVL+ E
Sbjct: 1000 VASWYSQIANYLVTGEVPSEWSAQDKRHFFAKIHAYYWDEPFLFKYCADQIIRKCVLEQE 1059

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1060 QSGILSHCHDSACGG 1074


>tr|A5BRS7|A5BRS7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016815 PE=4 SV=1
Length = 1836

Score = 132 bits (331), Expect = 2e-29
Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYASR L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1302 YYASRTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1361

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L +
Sbjct: 1362 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPEESLMSVD--- 1418

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1419 VAPWYSHIANFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1478

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1479 QSGILSHCHDNACGG 1493


>tr|A5BXM1|A5BXM1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030272 PE=4 SV=1
Length = 1449

Score = 131 bits (330), Expect = 2e-29
Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 4/197 (2%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYASR L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 843 YYASRTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 902

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRI----ETGELPTGVQDQLPNAKLFEIQS 232
RL RW+LLLQ+F+ I G E+ +AD+LSR+ ++ LP + D P L +
Sbjct: 903 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIXHDSHGLP--INDDFPEESLMSVD- 959

Query: 231 SIIDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLD 52
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV +
Sbjct: 960 --VAPWYSHIANFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPE 1017

Query: 51 FEQSVVLQEAHFGAVGG 1
EQS +L H A GG
Sbjct: 1018 QEQSGILSHCHDNACGG 1034


>tr|A5BAE8|A5BAE8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015506 PE=4 SV=1
Length = 1706

Score = 131 bits (330), Expect = 2e-29
Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYASR L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1158 YYASRTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1217

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L + +
Sbjct: 1218 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPEESLMSVDXA- 1276

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1277 --PWYSHIANFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1334

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1335 QSGILSHCHDNACGG 1349


>tr|A5AEM1|A5AEM1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001382 PE=4 SV=1
Length = 2497

Score = 131 bits (330), Expect = 2e-29
Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYASR L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1319 YYASRTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1378

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L + +
Sbjct: 1379 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVISHDSHGLPINDDFPEESLMSVDXA- 1437

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1438 --PWYSHIANFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1495

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1496 QSGILSHCHDSACGG 1510


>tr|A5ATF8|A5ATF8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033412 PE=4 SV=1
Length = 928

Score = 131 bits (329), Expect = 3e-29
Identities = 72/195 (36%), Positives = 107/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS+ L ++NY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 17 YYASKTLNEAQRNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 76

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L I+
Sbjct: 77 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPEESLMSIE--- 133

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 134 VAPWYSHIANFLVTGEVPSEWSAQDKRHFFAKIHAYYWXEPFLFKYCADQIIRKCVPEQE 193

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 194 QSGILSHCHDSACGG 208


>tr|A5AZ01|A5AZ01_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_017288 PE=4 SV=1
Length = 1481

Score = 130 bits (328), Expect = 4e-29
Identities = 72/195 (36%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS+ L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1097 YYASKTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1156

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L +
Sbjct: 1157 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPEESLMSVD--- 1213

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1214 VAPWYSHIANFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1273

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1274 QSGILSHCHDSACGG 1288


>tr|A5C647|A5C647_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_019683 PE=4 SV=1
Length = 2103

Score = 130 bits (327), Expect = 5e-29
Identities = 72/195 (36%), Positives = 107/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS+ L ++NY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1260 YYASKTLNEAQRNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1319

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L I+
Sbjct: 1320 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVISHDSHGLPINDDFPEESLMSIE--- 1376

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1377 VAPWYSHIANFLVTGEVPSEWSAQDKRHFFAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1436

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1437 QSGILSHCHDSACGG 1451


>tr|A5B147|A5B147_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026455 PE=4 SV=1
Length = 1726

Score = 130 bits (327), Expect = 5e-29
Identities = 72/195 (36%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS+ L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 1178 YYASKTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSSIVVFTDHSALKYLLTKQDAKA 1237

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L +
Sbjct: 1238 RLIRWILLLQEFNLQIRDKKGVENVVADHLSRLVIAHDSHGLPINDDFPEESLMSVD--- 1294

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1295 VAPWYSHIANFLVTGEVPSEWSAQDKRHFFAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1354

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1355 QSGILSHCHDSACGG 1369


>tr|A5AFI3|A5AFI3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033278 PE=4 SV=1
Length = 1467

Score = 130 bits (326), Expect = 7e-29
Identities = 72/195 (36%), Positives = 106/195 (54%), Gaps = 2/195 (1%)
Frame = -3

Query: 579 YYASRVLTFVEKNYAITEREALGMVYALNKFRHYLLCNRVIFHVDHQALLYLIKKPLLIG 400
YYAS+ L +KNY TE+E L +V+AL+KFR YL+ + ++ DH AL YL+ K
Sbjct: 919 YYASKTLNEAQKNYTTTEKELLAVVFALDKFRAYLVGSFIVVFTDHSALKYLLTKQDAKA 978

Query: 399 RLARWMLLLQDFDFIIVHTSGKEHAIADYLSRIETGELPTG--VQDQLPNAKLFEIQSSI 226
RL RW+LLLQ+F+ I G E+ +AD+LSR+ G + D P L +
Sbjct: 979 RLIRWILLLQEFNLQIKDKKGVENVVADHLSRLVIAHNSHGLPINDDFPEESLMSVD--- 1035

Query: 225 IDSWYDQMLVFLTDGIMPTEFTTNQRRKFALTSRPFLVIVGALYRKGIDQVIRRCVLDFE 46
+ WY + FL G +P+E++ +R F + L++ DQ+IR+CV + E
Sbjct: 1036 VAPWYSHIENFLVTGEVPSEWSAQDKRHFLAKIHAYYWEEPFLFKYCADQIIRKCVPEQE 1095

Query: 45 QSVVLQEAHFGAVGG 1
QS +L H A GG
Sbjct: 1096 QSGILSHCHDSACGG 1110