BP921213
Clone id YMU001_000147_A10
Library
Length 466
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000147_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTCTGAAGGAGGGTCCTCTAAAACAGTTGTGGCTCTTCGAGCAAGACCTCCCCAGAAACT
ATCCTCCACAATGTCCTCAGAATTCTCATCGGACATTGTTGATGACGCAGTTGACGAAGT
TGGAGAATTGTCACTGCTGGAGCAAGCCGTGGCCACCATAAACGAGCAGCCTCTTTTTGG
CTAAATCAAGGCTTGTTCTCAATTCGAGGCTGTAGACACCACTACAGCATAAAATGCTGC
TGGCGGAATTTGATTACTGCTCTTCCAAACTTGAAAAACCCTTAGAGTGTTCTCAAAGTA
CTCGAGGTGTCCATCAGCTCCTTACTCTGAAAATAGAGAGATCTCGTAACCAAATGACAT
ACTGTTTGGCCACCTGTTATCTACCTATCGCACTGACTATGAAACTGGTCGAAGAAAGGC
AGTCCTCCAATACTCCCGGTAGAGGAGAAAATGAAGAGGAGGGAGA
■■Homology search results ■■ -
sp_hit_id Q2TAF8
Definition sp|Q2TAF8|LONP2_XENLA Peroxisomal Lon protease homolog 2 OS=Xenopus laevis
Align length 48
Score (bit) 32.0
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921213|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_A10.
(466 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2TAF8|LONP2_XENLA Peroxisomal Lon protease homolog 2 OS=Xeno... 32 1.4
sp|P27271|AC4_TYLCI Protein C4 OS=Tomato yellow leaf curl virus ... 29 8.7
sp|Q8VYR5|PP351_ARATH Pentatricopeptide repeat-containing protei... 29 8.9
sp|Q2TB54|FCAMR_MOUSE High affinity immunoglobulin alpha and imm... 29 8.9

>sp|Q2TAF8|LONP2_XENLA Peroxisomal Lon protease homolog 2 OS=Xenopus
laevis GN=lonp2 PE=2 SV=1
Length = 856

Score = 32.0 bits (71), Expect = 1.4
Identities = 16/48 (33%), Positives = 29/48 (60%)
Frame = +2

Query: 20 KTVVALRARPPQKLSSTMSSEFSSDIVDDAVDEVGELSLLEQAVATIN 163
K +VA+R PP+KL + S FS + DD ++ ++ +LE+ + + N
Sbjct: 240 KRIVAIR--PPRKLGNISSKSFSLENTDDDDEDSDDIIILERKIKSSN 285


>sp|P27271|AC4_TYLCI Protein C4 OS=Tomato yellow leaf curl virus
(strain Israel) GN=C4 PE=3 SV=1
Length = 96

Score = 29.3 bits (64), Expect = 8.7
Identities = 15/44 (34%), Positives = 23/44 (52%)
Frame = -3

Query: 158 WWPRLAPAVTILQLRQLRHQQCPMRILRTLWRIVSGEVLLEEPQ 27
W+P+ ++I RQLR QQ + R WR ++LE P+
Sbjct: 26 WYPQTGQHISIRTFRQLRAQQ----MSRPTWRKTETSLILEFPK 65


>sp|Q8VYR5|PP351_ARATH Pentatricopeptide repeat-containing protein
At4g35850, mitochondrial OS=Arabidopsis thaliana
GN=At4g35850 PE=1 SV=1
Length = 444

Score = 29.3 bits (64), Expect = 8.9
Identities = 12/34 (35%), Positives = 21/34 (61%)
Frame = -2

Query: 309 HLEYFENTLRVFQVWKSSNQIPPAAFYAVVVSTA 208
H + FEN L++FQ + S+++IP Y ++ A
Sbjct: 303 HSQDFENGLKLFQDYMSADKIPAMELYTTLIEGA 336


>sp|Q2TB54|FCAMR_MOUSE High affinity immunoglobulin alpha and
immunoglobulin mu Fc receptor OS=Mus musculus GN=Fcamr
PE=1 SV=2
Length = 535

Score = 29.3 bits (64), Expect = 8.9
Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 8/50 (16%)
Frame = +1

Query: 157 HKRAASFWLNQGLFSIRGCRHHYSIK--------CCWRNLITALPNLKNP 282
H+R+ S WL G R H Y+++ CCW+N ++ L+ P
Sbjct: 40 HRRSHSRWLQAGSPQFR--THLYNVEAHTAPTPLCCWKNSLSGTNALRGP 87


tr_hit_id B3GVW3
Definition tr|B3GVW3|B3GVW3_NILLU Cytochrome P450 OS=Nilaparvata lugens
Align length 35
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921213|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_A10.
(466 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3GVW3|B3GVW3_NILLU Cytochrome P450 OS=Nilaparvata lugens GN=... 35 1.9

>tr|B3GVW3|B3GVW3_NILLU Cytochrome P450 OS=Nilaparvata lugens
GN=cyp4C61 PE=2 SV=1
Length = 502

Score = 35.0 bits (79), Expect = 1.9
Identities = 16/35 (45%), Positives = 19/35 (54%)
Frame = +1

Query: 124 RIVTAGASRGHHKRAASFWLNQGLFSIRGCRHHYS 228
R+VT G H A W+N LFS+ CR HYS
Sbjct: 380 RLVTEDMVVGEHLIPAGVWVNIELFSVHRCRDHYS 414