BP921258
Clone id YMU001_000147_E11
Library
Length 505
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000147_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGTGTGTTAGCATAGAAATGAAAGTTTAAGTCACCTAAATGCAAATAAAAAGAACTCCT
AAACTAAGGTCTCATACCTAGATTCCTAGAGGGAAAAAACCCAAAGGAAAAAAGTGCCTC
TAGAATGTACTGATGTATCTAGTGCACCATAATCAATCTTCACAAAGCAAGGGTCTAGTG
CAACTAGGAGGGATACGAGAACTCTCTCCAAACAATAGAACCTGTAATCTCCTAGCTCTC
TCTCTAATGGTCATCGGTTGGCTAGCACCTTGATCCATGTCAATGGTAGAATCTGTCACA
TAAGTAATGGGTCTATGGATGAGATCAGCCTCTGACCTGTGTGGGCAATGAACTTTGTGG
CTCAAGATCCCTCAATGGATGACTCCTGCTTAGTCTAAGTGAACAACATGGTCAATGGAA
ATCTCTACTGGACTATGACTCGTGTCTGGCTATGGTGTGATAGGTGGTCGGCTCTTTGGT
AGCCAAATGGAATGTCTACAGTATG
■■Homology search results ■■ -
sp_hit_id O58984
Definition sp|O58984|Y1269_PYRHO UPF0098 protein PH1269 OS=Pyrococcus horikoshii
Align length 94
Score (bit) 30.4
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921258|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_E11.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O58984|Y1269_PYRHO UPF0098 protein PH1269 OS=Pyrococcus horik... 30 4.9
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya go... 30 4.9

>sp|O58984|Y1269_PYRHO UPF0098 protein PH1269 OS=Pyrococcus
horikoshii GN=PH1269 PE=3 SV=1
Length = 198

Score = 30.4 bits (67), Expect = 4.9
Identities = 24/94 (25%), Positives = 43/94 (45%)
Frame = -3

Query: 485 WLPKSRPPITP*PDTSHSPVEISIDHVVHLD*AGVIH*GILSHKVHCPHRSEADLIHRPI 306
W+ + PP+T P+ P + +D +H+ G G + + CP R +
Sbjct: 102 WIAWNIPPVTEIPEGI--PKQGEVDKPIHII-QGRNDFGRIGYNGPCPPRGHGVHHYHFK 158

Query: 305 TYVTDSTIDMDQGASQPMTIRERARRLQVLLFGE 204
Y D+T+++ GAS+ E+A V+ +GE
Sbjct: 159 VYALDTTLNLKPGASRKEL--EKAMEGHVIQYGE 190


>sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya
gossypii GN=BEM2 PE=4 SV=1
Length = 2071

Score = 30.4 bits (67), Expect = 4.9
Identities = 15/41 (36%), Positives = 23/41 (56%)
Frame = +3

Query: 246 NGHRLASTLIHVNGRICHISNGSMDEISL*PVWAMNFVAQD 368
N H L +H+N H+ N MD +L V++M+F+ QD
Sbjct: 2002 NYHILKRLFLHLNRVHQHVENNRMDASNLAIVFSMSFINQD 2042


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921258|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_E11.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******