BP921276
Clone id YMU001_000147_G10
Library
Length 500
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000147_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGGTTGCTTTGACTCACTCGTGTTCCTATTCGGCAAACCAATCCCAATCTTCTTGGATG
CCCTCCTCAAAGCGTAGAGGAAAAAAAATTGTCGGAAAATTCAGCCTTGAATTGAATCCA
AGTCTTGTTGTAAGTTCCTTGCAGAGCCTTGGTATACCACCAAATACTTGCAATCCCCTT
GAGTTGTTTGGTCACATGCCTCACCTTTGACGCTTCTCAAAAATTGCCATTTGCAAAGGC
AACTTCATACTGTCGAATGATAGCGGTAGCTTTCAGGACATCTTCCCTTCCGTCAAAAGT
ATCAAACTTGACCGGAGGGTTCTGAGGTCTAAAGACCTTCATATCCTCACCGAAATGACG
GGATTTCTTGGCTATGGTTCTGGATTGATGTTCATGGATGTCTTCTGGGTTCTGAAGTAT
CTCGAGCATTCCGCTCCTCAGATTCTCTAGGTTCTTGAGCATCATGCTCTTGTCACCTTC
GCAATTCGCGGCCGCGAATT
■■Homology search results ■■ -
sp_hit_id Q9VPC0
Definition sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster
Align length 77
Score (bit) 31.2
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921276|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_G10.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=... 31 2.3
sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria mening... 30 4.0
sp|P11619|NEP_I83A1 Nuclear export protein OS=Influenza A virus ... 30 5.2
sp|Q3YPZ0|NEP_I71A1 Nuclear export protein OS=Influenza A virus ... 30 6.8
sp|A4VJR9|GLND_PSEU5 [Protein-PII] uridylyltransferase OS=Pseudo... 30 6.8
sp|A7Z4E6|MURB_BACA2 UDP-N-acetylenolpyruvoylglucosamine reducta... 29 8.9
sp|Q4ZWT0|GLND_PSEU2 [Protein-PII] uridylyltransferase OS=Pseudo... 29 8.9
sp|Q886P5|GLND_PSESM [Protein-PII] uridylyltransferase OS=Pseudo... 29 8.9

>sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE
OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1
Length = 952

Score = 31.2 bits (69), Expect = 2.3
Identities = 20/77 (25%), Positives = 41/77 (53%)
Frame = -3

Query: 466 EGDKSMMLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 287
E ++++ + +N ++E+L +PE H HQ + + +S+ + E+++V R + P +
Sbjct: 235 ERERTVRSTHKQNRHDRVIELLDSPEQEHHHQHQHKSHRSK-WREEVEVIR-RKVPEDLE 292

Query: 286 TFDGREDVLKATAIIRQ 236
RE +L A RQ
Sbjct: 293 LLARREKLLAAERESRQ 309


>sp|A1KSP4|ARLY_NEIMF Argininosuccinate lyase OS=Neisseria
meningitidis serogroup C / serotype 2a (strain ATCC
700532 / FAM18) GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = -3

Query: 448 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 287
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|Q9K0G8|ARLY_NEIMB Argininosuccinate lyase OS=Neisseria
meningitidis serogroup B GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = -3

Query: 448 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 287
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|Q9JVG7|ARLY_NEIMA Argininosuccinate lyase OS=Neisseria
meningitidis serogroup A GN=argH PE=3 SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = -3

Query: 448 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 287
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|A9M2R4|ARLY_NEIM0 Argininosuccinate lyase OS=Neisseria
meningitidis serogroup C (strain 053442) GN=argH PE=3
SV=1
Length = 458

Score = 30.4 bits (67), Expect = 4.0
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = -3

Query: 448 MLKNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD 287
M + LE +RSG +E + ED+H + R + K G+ + R +N V D
Sbjct: 64 MAEILEEIRSGKIEWSSDLEDVHMNIERRLTDKIGDAGKRLHTGRSRNDQVATD 117


>sp|P11619|NEP_I83A1 Nuclear export protein OS=Influenza A virus
(strain A/Chile/1/1983 H1N1) GN=NS PE=3 SV=1
Length = 121

Score = 30.0 bits (66), Expect = 5.2
Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 5/77 (6%)
Frame = +2

Query: 200 FSKIAICKGNFILSNDSGSFQDIFPSVKSIKLDR-----RVLRSKDLHILTEMTGFLGYG 364
F I + L + SG + +S+KL R V+R DLH L G
Sbjct: 9 FQDILMRMSKMQLGSSSGDLNGMITQFESLKLYRDSLGEAVMRMGDLHSLQNRNGKWREQ 68

Query: 365 SGLMFMDVFWVLKYLEH 415
G F ++ W+++ + H
Sbjct: 69 LGQKFEEIRWLIEEVRH 85


>sp|Q3YPZ0|NEP_I71A1 Nuclear export protein OS=Influenza A virus
(strain A/Memphis/1/1971 H3N2) GN=NS PE=3 SV=1
Length = 121

Score = 29.6 bits (65), Expect = 6.8
Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 5/77 (6%)
Frame = +2

Query: 200 FSKIAICKGNFILSNDSGSFQDIFPSVKSIKLDR-----RVLRSKDLHILTEMTGFLGYG 364
F I + L + S + +S+KL R V+R DLH L G
Sbjct: 9 FQDILLRMSKMQLGSSSEDLNGMITQFESLKLYRDSLGEAVMRMGDLHSLQNRNGKWREQ 68

Query: 365 SGLMFMDVFWVLKYLEH 415
GL F ++ W+++ + H
Sbjct: 69 LGLKFEEIRWLIEEVRH 85


>sp|A4VJR9|GLND_PSEU5 [Protein-PII] uridylyltransferase
OS=Pseudomonas stutzeri (strain A1501) GN=glnD PE=3 SV=1
Length = 900

Score = 29.6 bits (65), Expect = 6.8
Identities = 11/35 (31%), Positives = 22/35 (62%)
Frame = -3

Query: 442 KNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHF 338
+ +E +RSG++ L+NP+D R + ++ +HF
Sbjct: 764 ERIEEIRSGLIAALRNPDDYLTIIQRRVPRQLKHF 798


>sp|A7Z4E6|MURB_BACA2 UDP-N-acetylenolpyruvoylglucosamine reductase
OS=Bacillus amyloliquefaciens (strain FZB42) GN=murB
PE=3 SV=1
Length = 303

Score = 29.3 bits (64), Expect = 8.9
Identities = 17/70 (24%), Positives = 33/70 (47%)
Frame = +2

Query: 140 IPPNTCNPLELFGHMPHL*RFSKIAICKGNFILSNDSGSFQDIFPSVKSIKLDRRVLRSK 319
+P + N +E G H +K++ GNFI++ + +D+ ++ +K R
Sbjct: 231 LPDHAGNLVEKAGLKGHQIGGAKVSEMHGNFIVNAGGATAKDVLDLIEYVKKTIREQYDV 290

Query: 320 DLHILTEMTG 349
D+H E+ G
Sbjct: 291 DMHTEVEIIG 300


>sp|Q4ZWT0|GLND_PSEU2 [Protein-PII] uridylyltransferase
OS=Pseudomonas syringae pv. syringae (strain B728a)
GN=glnD PE=3 SV=1
Length = 898

Score = 29.3 bits (64), Expect = 8.9
Identities = 13/45 (28%), Positives = 25/45 (55%)
Frame = -3

Query: 442 KNLENLRSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQ 308
+ ++++R G+ E L+NP+D R + ++ +HF F PQ
Sbjct: 763 ERIQDIREGLTEALRNPDDYPTIIKRRVPRQLKHF-----AFAPQ 802


tr_hit_id Q2R193
Definition tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gypsy subclass OS=Oryza sativa subsp. japonica
Align length 93
Score (bit) 40.0
E-value 0.059
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921276|Adiantum capillus-veneris mRNA, clone:
YMU001_000147_G10.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gy... 40 0.059
tr|Q0ZLH4|Q0ZLH4_9ORYZ Polyprotein OS=Oryza australiensis PE=4 SV=1 40 0.059
tr|Q84KB1|Q84KB1_CUCME Gag-protease polyprotein OS=Cucumis melo ... 40 0.077
tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.17
tr|Q2QTW2|Q2QTW2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 38 0.22
tr|B4FMK6|B4FMK6_MAIZE Putative uncharacterized protein OS=Zea m... 37 0.38
tr|A5AZ16|A5AZ16_VITVI Putative uncharacterized protein OS=Vitis... 37 0.38
tr|Q4RQT6|Q4RQT6_TETNG Chromosome 2 SCAF15004, whole genome shot... 37 0.65
tr|Q7G774|Q7G774_ORYSJ Putative polyprotein (Retrotransposon pro... 36 0.85
tr|Q4QXS8|Q4QXS8_HORVD Polyprotein OS=Hordeum vulgare var. disti... 36 0.85
tr|Q01M74|Q01M74_ORYSA H0616A11.5 protein OS=Oryza sativa GN=H06... 36 0.85
tr|Q8LLB6|Q8LLB6_HORVU Sukkula-1b polyprotein OS=Hordeum vulgare... 36 1.1
tr|Q8LLB4|Q8LLB4_HORVU Sukkula-1a polyprotein OS=Hordeum vulgare... 36 1.1
tr|A5JSC4|A5JSC4_MAIZE Polyprotein OS=Zea mays PE=4 SV=1 36 1.1
tr|A2YTU7|A2YTU7_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.1
tr|Q2R4W2|Q2R4W2_ORYSJ Retrotransposon, putative, centromere-spe... 35 1.4
tr|Q2R1L3|Q2R1L3_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 1.4
tr|Q2QTC9|Q2QTC9_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 1.4
tr|Q2R3T2|Q2R3T2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 1.9
tr|A5B1A3|A5B1A3_VITVI Putative uncharacterized protein OS=Vitis... 35 1.9
tr|Q852G2|Q852G2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|Q7F2E9|Q7F2E9_ORYSJ Putative polyprotein OS=Oryza sativa subs... 34 3.2
tr|Q6F330|Q6F330_ORYSJ Putative polyprotein OS=Oryza sativa subs... 34 3.2
tr|Q53J53|Q53J53_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|Q10JR0|Q10JR0_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.2
tr|A5BDH9|A5BDH9_VITVI Putative uncharacterized protein OS=Vitis... 34 3.2
tr|Q7XUI0|Q7XUI0_ORYSJ OSJNBa0020J04.2 protein OS=Oryza sativa s... 34 4.2
tr|Q6UUS2|Q6UUS2_ORYSJ Putative gag-pol protein OS=Oryza sativa ... 34 4.2
tr|Q2QQZ1|Q2QQZ1_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 4.2
tr|Q0J6I2|Q0J6I2_ORYSJ Os08g0317300 protein OS=Oryza sativa subs... 34 4.2

>tr|Q2R193|Q2R193_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g39950 PE=4 SV=1
Length = 1712

Score = 40.0 bits (92), Expect = 0.059
Identities = 32/93 (34%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
Frame = -3

Query: 340 FGEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 161
FGE M+ PP TF E+ + A +R E EA KV QL+G
Sbjct: 389 FGEFMRT----KPP----TFATAEEPMDAEDCLRVIEKKLTLVRVREADKVIFAANQLEG 440

Query: 160 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNF 71
A WW Y +A + G TW +F A F +NF
Sbjct: 441 PAGDWWDTYKEAREDGAGEPTWEEFTAAFRENF 473


>tr|Q0ZLH4|Q0ZLH4_9ORYZ Polyprotein OS=Oryza australiensis PE=4 SV=1
Length = 1469

Score = 40.0 bits (92), Expect = 0.059
Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 3/92 (3%)
Frame = -3

Query: 337 GEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKGI 158
G + F PP TF E+ + A +R E EA +V T QL+G
Sbjct: 45 GSSLGEFMRAKPP----TFSTAEEPMDAEDWLRVIEKKLTLVRVREADRVVFATNQLEGP 100

Query: 157 ASIWWYT---KALQGTYNKTWIQFKAEFSDNF 71
AS WW T + TW +F A F +NF
Sbjct: 101 ASDWWDTYKETRAEDAGEPTWEEFTAAFRENF 132


>tr|Q84KB1|Q84KB1_CUCME Gag-protease polyprotein OS=Cucumis melo
PE=4 SV=1
Length = 429

Score = 39.7 bits (91), Expect = 0.077
Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 4/95 (4%)
Frame = -3

Query: 328 MKVFRPQNPPVKFDTFDGR-EDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKGIAS 152
++ FR NP TFDG ED +A + E F E KV+ L +
Sbjct: 60 LRDFRKYNPT----TFDGSLEDPTRAQMWLSSLETIFRYMKCPEDQKVQCAVFMLTDRGT 115

Query: 151 IWWYT--KALQGTYNK-TWIQFKAEFSDNFFSSTL 56
WW T + L G ++ TW QFK F FFS++L
Sbjct: 116 AWWETTERMLGGDVSQITWQQFKESFYAKFFSASL 150


>tr|Q2QR60|Q2QR60_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g28690 PE=4 SV=1
Length = 1470

Score = 38.5 bits (88), Expect = 0.17
Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 3/93 (3%)
Frame = -3

Query: 340 FGEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 161
FGE M+ PP TF ++ ++A +R E EA KV QL+G
Sbjct: 48 FGEFMRT----KPP----TFATADEPMEAEDWLRIIEKKLTLVRVREADKVIFAVNQLEG 99

Query: 160 IASIWW--YTKALQ-GTYNKTWIQFKAEFSDNF 71
A WW Y +A + G TW +F A F +NF
Sbjct: 100 PAGDWWDTYKEAREDGAGEPTWEEFTAAFRENF 132


>tr|Q2QTW2|Q2QTW2_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os12g18320 PE=4 SV=1
Length = 1226

Score = 38.1 bits (87), Expect = 0.22
Identities = 29/97 (29%), Positives = 41/97 (42%), Gaps = 3/97 (3%)
Frame = -3

Query: 352 KSRHFGEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTK 173
+ H G F PP TF ++ ++A +R E EA KV
Sbjct: 40 QGNHEGSSFGEFMSTKPP----TFTTTDEPMEAEDWLRIIEKKLTLIRVREADKVIFAVN 95

Query: 172 QLKGIASIWW--YTKALQGTYNK-TWIQFKAEFSDNF 71
QL+G A WW Y +A + + TW +F A F +NF
Sbjct: 96 QLEGPAGDWWDTYKEAREEDAGEPTWEEFTAAFRENF 132


>tr|B4FMK6|B4FMK6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 441

Score = 37.4 bits (85), Expect = 0.38
Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
Frame = -3

Query: 319 FRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFA--NGNF*EASKVRHVTKQLKGIASIW 146
F PP+ F ED L A +R E F +G E +KVR T+QL+G A W
Sbjct: 63 FLSTQPPL----FTRAEDPLDADVWLRVVESKFPLLHGVCSEVTKVRFATQQLRGPARTW 118

Query: 145 W-YTKALQGTYNKT-WIQFKAEF 83
W + A+Q + W +FKA F
Sbjct: 119 WDHFLAMQPEDREVEWREFKAAF 141


>tr|A5AZ16|A5AZ16_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016761 PE=4 SV=1
Length = 1404

Score = 37.4 bits (85), Expect = 0.38
Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 8/124 (6%)
Frame = -3

Query: 415 MLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFD---TFDGREDVLKATAI 245
++ + + E E + + + + +++ +++ P VK TF G+ D +
Sbjct: 103 VMSMFASVESRMEALTARVEARDQEIRQELAIYKTAAPRVKVPKPHTFSGKRDAKEIDNF 162

Query: 244 IRQYEVAF-ANGNF*EASKVRHVTKQLKGIASIWWYTKAL---QGTYN-KTWIQFKAEFS 80
+ E F A EA+KVR T L A++WW+ + +GT TW FK E
Sbjct: 163 LWHMERYFEAIALTDEATKVRTTTLYLTDNATLWWHRRFADIERGTCTIBTWDAFKREIK 222

Query: 79 DNFF 68
F+
Sbjct: 223 RQFY 226


>tr|Q4RQT6|Q4RQT6_TETNG Chromosome 2 SCAF15004, whole genome shotgun
sequence OS=Tetraodon nigroviridis GN=GSTENG00030465001
PE=4 SV=1
Length = 1605

Score = 36.6 bits (83), Expect = 0.65
Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 9/90 (10%)
Frame = -3

Query: 466 EGDKSMMLKNLENL--------RSGMLEILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRP 311
E D+SM + +E L + L+ Q + E Q RT+ K++ ++ P
Sbjct: 1207 EDDRSMATEQIEPLPKVLTPAKKPAALQKKQTQQKKTEKQERTVKPKAKAMRPKGRISTP 1266

Query: 310 QNPPVKFD-TFDGREDVLKATAIIRQYEVA 224
+ PV+ + + REDV K A+IR+ E A
Sbjct: 1267 ERKPVRTEPVYIPREDVKKKKAVIRKTEFA 1296


>tr|Q7G774|Q7G774_ORYSJ Putative polyprotein (Retrotransposon
protein, putative, Ty3-gypsy subclass) OS=Oryza sativa
subsp. japonica GN=OSJNBa0034B05.13 PE=4 SV=1
Length = 1569

Score = 36.2 bits (82), Expect = 0.85
Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 3/93 (3%)
Frame = -3

Query: 340 FGEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEVAFANGNF*EASKVRHVTKQLKG 161
FGE M+ PP TF + ++A +R E EA KV V QL+G
Sbjct: 259 FGEFMRT----KPP----TFAMADKPMEAEDWLRIIEKKLTLVRVREADKVIFVVNQLEG 310

Query: 160 IASIWW--YTKALQGTYNK-TWIQFKAEFSDNF 71
A WW Y +A + + TW +F A F +NF
Sbjct: 311 PAGDWWDTYKEAREEDAGEPTWEEFTAAFHENF 343


>tr|Q4QXS8|Q4QXS8_HORVD Polyprotein OS=Hordeum vulgare var.
distichum PE=4 SV=1
Length = 1486

Score = 36.2 bits (82), Expect = 0.85
Identities = 31/117 (26%), Positives = 46/117 (39%), Gaps = 1/117 (0%)
Frame = -3

Query: 406 ILQNPEDIHEHQSRTIAKKSRHFGEDMKVFRPQNPPVKFDTFDGREDVLKATAIIRQYEV 227
+LQ ++ HQ + HF + F P TF + A IR
Sbjct: 52 LLQLIQERANHQQGNFQQGGNHFAS-LSQFLSNQPR----TFTSCDQPFDAEDWIRDMNK 106

Query: 226 AFANGNF*EASKVRHVTKQLKGIASIWW-YTKALQGTYNKTWIQFKAEFSDNFFSST 59
N V+ T QLKG ASIWW + K +G +W +F +F ++ S+
Sbjct: 107 HSECSNVRPEDYVKFATFQLKGQASIWWQHLKDSRGGRVMSWDEFCRDFRSHYIPSS 163