BP921313
Clone id YMU001_000148_C12
Library
Length 504
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000148_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTACTGGTATTTTTTTTTCCAGAAGTCCACAACAAATATTAAGCAACAGGACAG
AGAAACATGCGCACACAATGCACTGTGCATGCACATAGCACGTGCACGTACATAACATAC
ATTATTATTCATCAAATGCATCAACCTCCCACATGCCTTCTTCCCTCAAATCTTTAGTAA
CTAGTTAAGCTCCTACACCAGAATAAGCTCGACCTGGGAGACAAAAAGTTGCTCAAGAAG
CATCAGTGTCTGTGAACGATGTCAAATGGGGAACAGAGGCCAGCTGGACTTTTTCCAACG
AAGGGCATGCAAGCCGGACCATGCTCCTAGGGGACAAAAGGTTGCAGCAGAAGCATCGGA
ATGTAGGGATGACATCAAGTGGGAAGCAGTGGCCAGTTGAATTTTTTTCATCATAGGGCA
TGTGATGCAGGCAATGATCACCTCCACCCAAACGTAACTGTGTCTTATATGCTTCTCATT
TGAAGCTGGCCACCATCATTACCA
■■Homology search results ■■ -
sp_hit_id Q96P88
Definition sp|Q96P88|GNRR2_HUMAN Putative gonadotropin-releasing hormone II receptor OS=Homo sapiens
Align length 64
Score (bit) 32.0
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921313|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_C12.
(504 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96P88|GNRR2_HUMAN Putative gonadotropin-releasing hormone II... 32 1.7
sp|Q95JG1|GNRR2_MACMU Gonadotropin-releasing hormone II receptor... 31 2.9
sp|Q6UXS0|YP004_HUMAN C-type lectin domain-containing protein UN... 31 3.8
sp|Q95MH6|GNRR2_CERAE Gonadotropin-releasing hormone II receptor... 31 3.8
sp|Q5WDW1|LUXS_BACSK S-ribosylhomocysteine lyase OS=Bacillus cla... 30 4.9
sp|Q95MG6|GNRR2_CALJA Gonadotropin-releasing hormone II receptor... 30 4.9
sp|Q925Q5|GPHA2_MOUSE Glycoprotein hormone alpha-2 OS=Mus muscul... 30 6.4
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus ... 30 8.3
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus m... 30 8.3
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo ... 30 8.3
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos t... 30 8.3
sp|Q9PK53|DNAJ_CHLMU Chaperone protein dnaJ OS=Chlamydia muridar... 30 8.3

>sp|Q96P88|GNRR2_HUMAN Putative gonadotropin-releasing hormone II
receptor OS=Homo sapiens GN=GNRHR2 PE=5 SV=3
Length = 178

Score = 32.0 bits (71), Expect = 1.7
Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
Frame = -1

Query: 450 WVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHAL---RWKKSSW 280
W+ V IAC T +K + +A+ L + D AA PLG+ SG+ L W S
Sbjct: 106 WLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFL 165

Query: 279 PLFP 268
FP
Sbjct: 166 LAFP 169


>sp|Q95JG1|GNRR2_MACMU Gonadotropin-releasing hormone II receptor
OS=Macaca mulatta GN=GNRHR2 PE=2 SV=1
Length = 379

Score = 31.2 bits (69), Expect = 2.9
Identities = 24/77 (31%), Positives = 37/77 (48%)
Frame = -1

Query: 450 WVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHALRWKKSSWPLF 271
W+ IAC T +K + + +A+ L + D AA PLG+ SG+ L ++W L
Sbjct: 106 WLAEDIACRTLMFLKLMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKL--LGAAWGL- 162

Query: 270 PI*HRSQTLMLLEQLFV 220
L+ L QLF+
Sbjct: 163 ------SFLLALPQLFL 173


>sp|Q6UXS0|YP004_HUMAN C-type lectin domain-containing protein
UNQ5810/PRO19627 OS=Homo sapiens GN=UNQ5810/PRO19627
PE=2 SV=1
Length = 136

Score = 30.8 bits (68), Expect = 3.8
Identities = 13/33 (39%), Positives = 18/33 (54%)
Frame = -1

Query: 333 PLGAWSGLHALRWKKSSWPLFPI*HRSQTLMLL 235
P W+GLH R + WPL P+ SQ +L+
Sbjct: 104 PADVWTGLHDHRQVRKQWPLGPLGSSSQDSILI 136


>sp|Q95MH6|GNRR2_CERAE Gonadotropin-releasing hormone II receptor
OS=Cercopithecus aethiops GN=GNRHR2 PE=2 SV=1
Length = 379

Score = 30.8 bits (68), Expect = 3.8
Identities = 24/77 (31%), Positives = 37/77 (48%)
Frame = -1

Query: 450 WVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHALRWKKSSWPLF 271
W+ IAC T +K + + +A+ L + D AA PLG+ SG+ L ++W L
Sbjct: 106 WLAGDIACRTLMFLKLMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKL--LGAAWGL- 162

Query: 270 PI*HRSQTLMLLEQLFV 220
L+ L QLF+
Sbjct: 163 ------SFLLALPQLFL 173


>sp|Q5WDW1|LUXS_BACSK S-ribosylhomocysteine lyase OS=Bacillus
clausii (strain KSM-K16) GN=luxS PE=3 SV=1
Length = 156

Score = 30.4 bits (67), Expect = 4.9
Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
Frame = +1

Query: 367 G*HQVGSSGQLNFFHHRACDAGNDHLHPNV--TVSYMLLI 480
G H++GS G++N F R C + L P V T+ ++L I
Sbjct: 23 GKHKIGSDGEVNKFDIRFCQPNKEALKPGVIHTLEHLLAI 62


>sp|Q95MG6|GNRR2_CALJA Gonadotropin-releasing hormone II receptor
OS=Callithrix jacchus GN=GNRHR2 PE=2 SV=1
Length = 380

Score = 30.4 bits (67), Expect = 4.9
Identities = 24/77 (31%), Positives = 36/77 (46%)
Frame = -1

Query: 450 WVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHALRWKKSSWPLF 271
W+ IAC T +K + + A+ L + D AA PLG+ SG+ L ++W L
Sbjct: 106 WLAGDIACRTLMFLKLMAMYAAAFLPVVIGLDRQAAVLNPLGSRSGVRKL--LGAAWGL- 162

Query: 270 PI*HRSQTLMLLEQLFV 220
L+ L QLF+
Sbjct: 163 ------SFLLALPQLFL 173


>sp|Q925Q5|GPHA2_MOUSE Glycoprotein hormone alpha-2 OS=Mus musculus
GN=Gpha2 PE=2 SV=1
Length = 128

Score = 30.0 bits (66), Expect = 6.4
Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%)
Frame = +2

Query: 161 FPQIFSN*LSSYTRISSTWETKSCS----RSISVCERCQMGNRGQLDFFQRRACKPD 319
FP +S ++S R + T ++ C+ R + V +C RG+L+ F RAC+ D
Sbjct: 65 FPSRYSVLVASGYRHNITSSSQCCTISSLRKVRVWLQCVGNQRGELEIFTARACQCD 121


>sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus
norvegicus GN=Dnajc5 PE=1 SV=1
Length = 198

Score = 29.6 bits (65), Expect = 8.3
Identities = 16/37 (43%), Positives = 18/37 (48%)
Frame = -3

Query: 121 CMLCTCTCYVHAQCIVCACFSVLLLNICCGLLEKKIP 11
C L TC CY C +C CF N CCG + K P
Sbjct: 113 CGLLTC-CY--CCCCLCCCF-----NCCCGKCKPKAP 141


>sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus
musculus GN=Dnajc5 PE=1 SV=1
Length = 198

Score = 29.6 bits (65), Expect = 8.3
Identities = 16/37 (43%), Positives = 18/37 (48%)
Frame = -3

Query: 121 CMLCTCTCYVHAQCIVCACFSVLLLNICCGLLEKKIP 11
C L TC CY C +C CF N CCG + K P
Sbjct: 113 CGLLTC-CY--CCCCLCCCF-----NCCCGKCKPKAP 141


>sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo
sapiens GN=DNAJC5 PE=1 SV=1
Length = 198

Score = 29.6 bits (65), Expect = 8.3
Identities = 16/37 (43%), Positives = 18/37 (48%)
Frame = -3

Query: 121 CMLCTCTCYVHAQCIVCACFSVLLLNICCGLLEKKIP 11
C L TC CY C +C CF N CCG + K P
Sbjct: 113 CGLLTC-CY--CCCCLCCCF-----NCCCGKCKPKAP 141


tr_hit_id Q8ZKK1
Definition tr|Q8ZKK1|Q8ZKK1_SALTY Putative inner membrane protein OS=Salmonella typhimurium
Align length 73
Score (bit) 39.3
E-value 0.11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921313|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_C12.
(504 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8ZKK1|Q8ZKK1_SALTY Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5F1L9|B5F1L9_SALA4 Putative inner membrane protein OS=Salmon... 39 0.11
tr|B4TDI2|B4TDI2_SALHS Putative inner membrane protein OS=Salmon... 39 0.11
tr|B4T1P4|B4T1P4_SALNS Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5Q4Q0|B5Q4Q0_SALVI Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5PYC3|B5PYC3_SALHA Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5P629|B5P629_SALET Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5NPP8|B5NPP8_SALET Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5MYD8|B5MYD8_SALET Putative inner membrane protein OS=Salmon... 39 0.11
tr|B5BVS8|B5BVS8_SALET Putative inner membrane protein OS=Salmon... 39 0.11
tr|B4A9Q5|B4A9Q5_SALNE Putative inner membrane protein OS=Salmon... 39 0.11
tr|B3YH64|B3YH64_SALET Putative inner membrane protein OS=Salmon... 39 0.11
tr|Q1QFZ5|Q1QFZ5_NITHX Putative uncharacterized protein OS=Nitro... 37 0.71

>tr|Q8ZKK1|Q8ZKK1_SALTY Putative inner membrane protein
OS=Salmonella typhimurium GN=STM4204 PE=4 SV=1
Length = 515

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 43 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 98

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 99 LRWNKSDYLLFPL 111


>tr|B5F1L9|B5F1L9_SALA4 Putative inner membrane protein
OS=Salmonella agona (strain SL483) GN=SeAg_B4457 PE=4
SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B4TDI2|B4TDI2_SALHS Putative inner membrane protein
OS=Salmonella heidelberg (strain SL476) GN=SeHA_C4541
PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B4T1P4|B4T1P4_SALNS Putative inner membrane protein
OS=Salmonella newport (strain SL254) GN=SNSL254_A4542
PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5Q4Q0|B5Q4Q0_SALVI Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar Virchow
str. SL491 GN=SeV_B0720 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5PYC3|B5PYC3_SALHA Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar Hadar
str. RI_05P066 GN=SeH_A4684 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5P629|B5P629_SALET Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar
Heidelberg str. SL486 GN=SeHB_A4338 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5NPP8|B5NPP8_SALET Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar Kentucky
str. CDC 191 GN=SeKB_A4389 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5MYD8|B5MYD8_SALET Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar
4,[5],12:i:- str. CVM23701 GN=SeI_A3849 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108


>tr|B5BVS8|B5BVS8_SALET Putative inner membrane protein
OS=Salmonella enterica subsp. enterica serovar Saintpaul
str. SARA23 GN=SeSPA_A0062 PE=4 SV=1
Length = 512

Score = 39.3 bits (90), Expect = 0.11
Identities = 25/73 (34%), Positives = 33/73 (45%)
Frame = -1

Query: 483 SNEKHIRHSYVWVEVIIACITCPMMKKIQLATASHLMSSLHSDASAATFCPLGAWSGLHA 304
S E H H W IIA T ++ L T S L+ S+ + S FC +
Sbjct: 40 SPESHFHHYMTWSGRIIADYTSALI----LYTRSQLVYSISAAVSTLVFCYFIVKTPSGT 95

Query: 303 LRWKKSSWPLFPI 265
LRW KS + LFP+
Sbjct: 96 LRWNKSDYLLFPL 108