BP921326
Clone id YMU001_000148_E03
Library
Length 311
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000148_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCGATCTCATGGATGATGCCAACTTTGTTTTTGAGACAGCCAATTCTGCAATTTTACGC
CTAACAAAAGAGATCACATGGATGAAAGAGGTCTTAGCAGCGGAGCAGTCTTTGAGGAAA
GAACCTCCGACCCTCTTTGCTGACAGAGTGTTTCAGAATGAAATTAATTTCTCTGTACAT
GTGACAGAACAGAATGATGAAAGTATGATGTTTAGAGATGCATTGAAAACTGGCTTGTAT
GATCTTCAGACAGCTCGTGACGAGTATCGTCTCTCCTGTGGTGCCATAGGAATGAATGGG
GATCTCATCTA
■■Homology search results ■■ -
sp_hit_id Q8BMJ2
Definition sp|Q8BMJ2|SYLC_MOUSE Leucyl-tRNA synthetase, cytoplasmic OS=Mus musculus
Align length 103
Score (bit) 93.6
E-value 3.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921326|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_E03.
(311 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BMJ2|SYLC_MOUSE Leucyl-tRNA synthetase, cytoplasmic OS=Mus ... 94 3e-19
sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo... 93 4e-19
sp|Q5R614|SYLC_PONAB Leucyl-tRNA synthetase, cytoplasmic OS=Pong... 93 5e-19
sp|Q09996|SYLC_CAEEL Leucyl-tRNA synthetase OS=Caenorhabditis el... 89 9e-18
sp|Q10490|SYLC_SCHPO Putative leucyl-tRNA synthetase, cytoplasmi... 77 3e-14
sp|Q54N83|SYLC_DICDI Leucyl-tRNA synthetase, cytoplasmic OS=Dict... 70 2e-12
sp|P26637|SYLC_YEAST Leucyl-tRNA synthetase, cytoplasmic OS=Sacc... 67 2e-11
sp|P10857|SYLC_NEUCR Leucyl-tRNA synthetase, cytoplasmic OS=Neur... 66 5e-11
sp|Q9YD97|SYL_AERPE Leucyl-tRNA synthetase OS=Aeropyrum pernix G... 32 0.98
sp|P38165|RTG3_YEAST Retrograde regulation protein 3 OS=Saccharo... 31 2.2
sp|Q9CMK5|SYV_PASMU Valyl-tRNA synthetase OS=Pasteurella multoci... 30 3.7
sp|Q6CDD0|SMP3_YARLI GPI mannosyltransferase 4 OS=Yarrowia lipol... 30 4.9
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II su... 30 4.9
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 O... 29 8.3
sp|Q6GMF8|RHDF1_DANRE Rhomboid family member 1 OS=Danio rerio GN... 29 8.3
sp|P57928|LYXK_PASMU Probable L-xylulose kinase OS=Pasteurella m... 29 8.3
sp|O18388|IMB_DROME Importin subunit beta OS=Drosophila melanoga... 29 8.3
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidio... 29 8.3

>sp|Q8BMJ2|SYLC_MOUSE Leucyl-tRNA synthetase, cytoplasmic OS=Mus
musculus GN=Lars PE=2 SV=2
Length = 1178

Score = 93.6 bits (231), Expect = 3e-19
Identities = 48/103 (46%), Positives = 69/103 (66%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD ++DANFV A++ ILRL + W+KE+LA+ SLR P F DRVF +E+N +
Sbjct: 749 GDTVEDANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGII 808

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
T+QN E MMF++ALKTG ++ Q A+D+YR GM+ +L+
Sbjct: 809 KTDQNYEKMMFKEALKTGFFEFQAAKDKYR-ELATEGMHRELV 850


>sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo
sapiens GN=LARS PE=1 SV=2
Length = 1176

Score = 93.2 bits (230), Expect = 4e-19
Identities = 47/103 (45%), Positives = 69/103 (66%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD ++DANFV A++ ILRL + W+KE++A SLR P + F DRVF +E+N +
Sbjct: 747 GDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGII 806

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
T+QN E MMF++ALKTG ++ Q A+D+YR GM+ +L+
Sbjct: 807 KTDQNYEKMMFKEALKTGFFEFQAAKDKYR-ELAVEGMHRELV 848


>sp|Q5R614|SYLC_PONAB Leucyl-tRNA synthetase, cytoplasmic OS=Pongo
abelii GN=LARS PE=2 SV=1
Length = 1176

Score = 92.8 bits (229), Expect = 5e-19
Identities = 47/103 (45%), Positives = 68/103 (66%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD ++DANFV A++ ILRL + W+KE++A SLR P F DRVF +E+N +
Sbjct: 747 GDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPANTFNDRVFASELNAGII 806

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
T+QN E MMF++ALKTG ++ Q A+D+YR GM+ +L+
Sbjct: 807 KTDQNYEKMMFKEALKTGFFEFQAAKDKYR-ELAVEGMHRELV 848


>sp|Q09996|SYLC_CAEEL Leucyl-tRNA synthetase OS=Caenorhabditis elegans
GN=lrs-1 PE=2 SV=2
Length = 1186

Score = 88.6 bits (218), Expect = 9e-18
Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQS--LRKEPPTLFADRVFQNEINFS 174
GD ++DANFV+ A++AILRL I W+KE++ + LRK+ FADRVF NE+N
Sbjct: 749 GDGLEDANFVYAMADAAILRLFTMIEWIKEMIEQRDAGLLRKDAKK-FADRVFANEMNSL 807

Query: 175 VHVTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAI 288
+ TEQN E+ F+DALKTG ++ Q RD YR C I
Sbjct: 808 IAATEQNYEATNFKDALKTGFFEYQAIRDTYRELCAGI 845


>sp|Q10490|SYLC_SCHPO Putative leucyl-tRNA synthetase, cytoplasmic
OS=Schizosaccharomyces pombe GN=SPAC26F1.13c PE=1 SV=1
Length = 1111

Score = 77.0 bits (188), Expect = 3e-14
Identities = 45/103 (43%), Positives = 61/103 (59%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD +DDANF ANSAILRL + W KE++ +LR P F D+VF+NEIN +
Sbjct: 768 GDTVDDANFEEALANSAILRLYTQEAWCKEMMENLDNLRTGPYN-FHDKVFENEINQLIE 826

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
+ + + +F+ ALK+ YDLQ ARD YR M+ DL+
Sbjct: 827 SSREAFSATLFKAALKSCFYDLQNARDWYREVTADRKMHRDLV 869


>sp|Q54N83|SYLC_DICDI Leucyl-tRNA synthetase, cytoplasmic
OS=Dictyostelium discoideum GN=leuS PE=3 SV=1
Length = 1058

Score = 70.5 bits (171), Expect = 2e-12
Identities = 35/92 (38%), Positives = 57/92 (61%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD ++DANFV +TA +++L+L +I W++E L + R P D +F++EIN +
Sbjct: 742 GDSIEDANFVDQTAVTSLLKLHTQIQWVQETLDSIDKFRSGPLDRIQDTIFESEINNIIV 801

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLS 276
+E+ + FRDAL +DLQ ARD Y+++
Sbjct: 802 ESEKAYQKTNFRDALHLVFFDLQNARDHYKVT 833


>sp|P26637|SYLC_YEAST Leucyl-tRNA synthetase, cytoplasmic
OS=Saccharomyces cerevisiae GN=CDC60 PE=1 SV=1
Length = 1090

Score = 67.4 bits (163), Expect = 2e-11
Identities = 42/103 (40%), Positives = 59/103 (57%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD ++DANF AN+AILRL W +E+ E +LR T F D F++E+N +
Sbjct: 760 GDTVEDANFDESNANAAILRLFNLKEWAEEI-TKESNLRTGEITDFFDIAFEHEMNALIE 818

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
T + +++ALK GL+D Q ARD YR + G M+ DLI
Sbjct: 819 KTYEQYALTNYKNALKYGLFDFQAARDYYREASGV--MHKDLI 859


>sp|P10857|SYLC_NEUCR Leucyl-tRNA synthetase, cytoplasmic
OS=Neurospora crassa GN=leu-6 PE=3 SV=2
Length = 1123

Score = 66.2 bits (160), Expect = 5e-11
Identities = 37/98 (37%), Positives = 55/98 (56%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD + D+NFV + A++ ILR W++E L ++SLR F D +F NE+N V+
Sbjct: 788 GDGISDSNFVEDVADNTILRFYTNKEWIEETLK-DESLRTGELNSFQDALFDNEMNALVN 846

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGM 294
++ E ++ ALK YD ARD YR +C A G+
Sbjct: 847 EARKHYEETSYKLALKAAHYDFLNARDMYREACAAAGI 884


>sp|Q9YD97|SYL_AERPE Leucyl-tRNA synthetase OS=Aeropyrum pernix
GN=leuS PE=3 SV=1
Length = 959

Score = 32.0 bits (71), Expect = 0.98
Identities = 23/80 (28%), Positives = 42/80 (52%)
Frame = +1

Query: 10 MDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVHVTE 189
+DDANF A+SA+ L++ + +++E + R+E + DR F++ +N ++
Sbjct: 673 LDDANFEPSVADSAVSLLSQWLDFVRENYG--RPARRE--ERWVDRWFESRLNSTIARVT 728

Query: 190 QNDESMMFRDALKTGLYDLQ 249
+ E F+ AL Y LQ
Sbjct: 729 RLMEEANFKTALVEAWYKLQ 748


>sp|P38165|RTG3_YEAST Retrograde regulation protein 3
OS=Saccharomyces cerevisiae GN=RTG3 PE=1 SV=2
Length = 486

Score = 30.8 bits (68), Expect = 2.2
Identities = 12/26 (46%), Positives = 17/26 (65%)
Frame = -2

Query: 301 PHSFLWHHRRDDTRHELSEDHTSQFS 224
PH FL+ H DDT + L++D +S S
Sbjct: 163 PHDFLFQHGTDDTMYNLTDDLSSSLS 188


tr_hit_id Q6H4P7
Definition tr|Q6H4P7|Q6H4P7_ORYSJ Os09g0378300 protein OS=Oryza sativa subsp. japonica
Align length 103
Score (bit) 149.0
E-value 7.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921326|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_E03.
(311 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6H4P7|Q6H4P7_ORYSJ Os09g0378300 protein OS=Oryza sativa subs... 149 7e-35
tr|A2Z0N8|A2Z0N8_ORYSI Putative uncharacterized protein OS=Oryza... 149 7e-35
tr|Q0J0N6|Q0J0N6_ORYSJ Os09g0503400 protein OS=Oryza sativa subs... 147 2e-34
tr|B8BDA2|B8BDA2_ORYSI Putative uncharacterized protein OS=Oryza... 147 2e-34
tr|A3C0D8|A3C0D8_ORYSJ Putative uncharacterized protein OS=Oryza... 147 2e-34
tr|A9RZT5|A9RZT5_PHYPA Predicted protein OS=Physcomitrella paten... 144 2e-33
tr|A7PQ01|A7PQ01_VITVI Chromosome chr18 scaffold_24, whole genom... 142 6e-33
tr|A5BXP3|A5BXP3_VITVI Putative uncharacterized protein OS=Vitis... 142 6e-33
tr|A7QC89|A7QC89_VITVI Chromosome undetermined scaffold_77, whol... 140 2e-32
tr|A5AFM3|A5AFM3_VITVI Putative uncharacterized protein OS=Vitis... 140 2e-32
tr|Q56WB9|Q56WB9_ARATH Putative leucyl-tRNA synthetase OS=Arabid... 137 4e-31
tr|O04485|O04485_ARATH F21M12.1 protein OS=Arabidopsis thaliana ... 137 4e-31
tr|Q9LPN1|Q9LPN1_ARATH F2J10.2 protein OS=Arabidopsis thaliana G... 130 3e-29
tr|Q01B72|Q01B72_OSTTA Putative leucyl-tRNA synthetase (ISS) OS=... 108 1e-22
tr|A2Q4Y9|A2Q4Y9_MEDTR Aminoacyl-tRNA synthetase, class Ia OS=Me... 108 2e-22
tr|A4RVT8|A4RVT8_OSTLU Predicted protein OS=Ostreococcus lucimar... 106 5e-22
tr|B4MV75|B4MV75_DROWI GK14672 OS=Drosophila willistoni GN=GK146... 105 9e-22
tr|B4JQG2|B4JQG2_DROGR GH13195 OS=Drosophila grimshawi GN=GH1319... 103 4e-21
tr|B3MP31|B3MP31_DROAN GF14667 OS=Drosophila ananassae GN=GF1466... 103 4e-21
tr|B4LRU6|B4LRU6_DROVI GJ17599 OS=Drosophila virilis GN=GJ17599 ... 103 6e-21
tr|B3N334|B3N334_DROER GG24431 OS=Drosophila erecta GN=GG24431 P... 102 7e-21
tr|B4NXX9|B4NXX9_DROYA GE14851 OS=Drosophila yakuba GN=GE14851 P... 102 1e-20
tr|Q9VQR8|Q9VQR8_DROME CG33123 OS=Drosophila melanogaster GN=CG3... 102 1e-20
tr|Q8MRF8|Q8MRF8_DROME SD07726p OS=Drosophila melanogaster GN=CG... 102 1e-20
tr|B4Q9L5|B4Q9L5_DROSI GD22750 OS=Drosophila simulans GN=GD22750... 101 2e-20
tr|B4I2Z8|B4I2Z8_DROSE GM18143 OS=Drosophila sechellia GN=GM1814... 101 2e-20
tr|B4KK92|B4KK92_DROMO GI17774 OS=Drosophila mojavensis GN=GI177... 100 4e-20
tr|Q29MC7|Q29MC7_DROPS GA17300 OS=Drosophila pseudoobscura pseud... 99 1e-19
tr|B4G9F6|B4G9F6_DROPE GL19473 OS=Drosophila persimilis GN=GL194... 99 1e-19
tr|A7S771|A7S771_NEMVE Predicted protein (Fragment) OS=Nematoste... 99 1e-19

>tr|Q6H4P7|Q6H4P7_ORYSJ Os09g0378300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0041C07.40 PE=2 SV=1
Length = 1094

Score = 149 bits (376), Expect = 7e-35
Identities = 74/103 (71%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETAN+AILRLTKEI WM+EV+AAE SLR PP+ +AD VF NEIN +V
Sbjct: 748 GDGMDDANFVFETANAAILRLTKEIAWMEEVIAAESSLRTGPPSTYADHVFANEINIAVI 807

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
TE++ + MFRDALK G YDLQ ARDEYRLSCGA GMN DL+
Sbjct: 808 ETEKSYNAFMFRDALKLGFYDLQLARDEYRLSCGAAGMNRDLL 850


>tr|A2Z0N8|A2Z0N8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31164 PE=4 SV=1
Length = 1094

Score = 149 bits (376), Expect = 7e-35
Identities = 74/103 (71%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETAN+AILRLTKEI WM+EV+AAE SLR PP+ +AD VF NEIN +V
Sbjct: 748 GDGMDDANFVFETANAAILRLTKEIAWMEEVIAAESSLRTGPPSTYADHVFANEINIAVI 807

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
TE++ + MFRDALK G YDLQ ARDEYRLSCGA GMN DL+
Sbjct: 808 ETEKSYNAFMFRDALKLGFYDLQLARDEYRLSCGAAGMNRDLL 850


>tr|Q0J0N6|Q0J0N6_ORYSJ Os09g0503400 protein OS=Oryza sativa subsp.
japonica GN=Os09g0503400 PE=4 SV=1
Length = 1029

Score = 147 bits (372), Expect = 2e-34
Identities = 73/103 (70%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETAN+AILRLTKEI WM+EV+AAE SLR PP+ +AD VF NEIN +V
Sbjct: 750 GDGMDDANFVFETANAAILRLTKEIAWMEEVIAAESSLRAGPPSTYADHVFANEINIAVI 809

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
TE++ + MFRDALK G YDLQ ARDEYRLSCGA GMN +L+
Sbjct: 810 ETEKSYNAFMFRDALKLGFYDLQLARDEYRLSCGAAGMNRELL 852


>tr|B8BDA2|B8BDA2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31937 PE=4 SV=1
Length = 382

Score = 147 bits (372), Expect = 2e-34
Identities = 73/103 (70%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETAN+AILRLTKEI WM+EV+AAE SLR PP+ +AD VF NEIN +V
Sbjct: 37 GDGMDDANFVFETANAAILRLTKEIAWMEEVIAAESSLRAGPPSTYADHVFANEINIAVI 96

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
TE++ + MFRDALK G YDLQ ARDEYRLSCGA GMN +L+
Sbjct: 97 ETEKSYNAFMFRDALKLGFYDLQLARDEYRLSCGAAGMNRELL 139


>tr|A3C0D8|A3C0D8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028760 PE=4 SV=1
Length = 1033

Score = 147 bits (372), Expect = 2e-34
Identities = 73/103 (70%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETAN+AILRLTKEI WM+EV+AAE SLR PP+ +AD VF NEIN +V
Sbjct: 688 GDGMDDANFVFETANAAILRLTKEIAWMEEVIAAESSLRAGPPSTYADHVFANEINIAVI 747

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
TE++ + MFRDALK G YDLQ ARDEYRLSCGA GMN +L+
Sbjct: 748 ETEKSYNAFMFRDALKLGFYDLQLARDEYRLSCGAAGMNRELL 790


>tr|A9RZT5|A9RZT5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_207285 PE=4 SV=1
Length = 1104

Score = 144 bits (364), Expect = 2e-33
Identities = 70/103 (67%), Positives = 83/103 (80%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFVFETANSAILRLTKEI WM++V+ A+ LR P T F DRVF+NE+N ++
Sbjct: 755 GDAMDDANFVFETANSAILRLTKEIAWMEQVIGADLVLRSGPTTSFPDRVFENELNIAIK 814

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
T+ + + MFRDALKTG YDLQTARDEYRL+CGA GM+ DLI
Sbjct: 815 ETQMHYSNYMFRDALKTGFYDLQTARDEYRLACGAEGMHKDLI 857


>tr|A7PQ01|A7PQ01_VITVI Chromosome chr18 scaffold_24, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021859001
PE=4 SV=1
Length = 1031

Score = 142 bits (359), Expect = 6e-33
Identities = 70/103 (67%), Positives = 81/103 (78%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFV ETAN+AILRLTKEI+WM+EV+ E S RK P + +ADRVF NEIN +V
Sbjct: 695 GDGMDDANFVSETANAAILRLTKEISWMQEVIEGESSFRKGPSSTYADRVFANEINIAVK 754

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
+TE+N MFR+ALKTG YDLQ ARDEYR SCG GMN DL+
Sbjct: 755 MTEKNYSEFMFREALKTGFYDLQAARDEYRFSCGMGGMNRDLL 797


>tr|A5BXP3|A5BXP3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024181 PE=4 SV=1
Length = 1055

Score = 142 bits (359), Expect = 6e-33
Identities = 70/103 (67%), Positives = 81/103 (78%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD MDDANFV ETAN+AILRLTKEI+WM+EV+ E S RK P + +ADRVF NEIN +V
Sbjct: 719 GDGMDDANFVSETANAAILRLTKEISWMQEVIEGESSFRKGPSSTYADRVFANEINIAVK 778

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
+TE+N MFR+ALKTG YDLQ ARDEYR SCG GMN DL+
Sbjct: 779 MTEKNYSEFMFREALKTGFYDLQAARDEYRFSCGMGGMNRDLL 821


>tr|A7QC89|A7QC89_VITVI Chromosome undetermined scaffold_77, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00035298001 PE=4 SV=1
Length = 1025

Score = 140 bits (354), Expect = 2e-32
Identities = 70/103 (67%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD +DDANFVFETAN+AILRLTKE++WM+EVL AE SLR + +AD+VF NEIN +V
Sbjct: 687 GDGVDDANFVFETANAAILRLTKELSWMEEVLEAEASLRTGALSTYADQVFANEINIAVT 746

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
+TEQ+ + MFR+ALKTG YDLQ ARDEYR SCGA GMN DL+
Sbjct: 747 LTEQHYRNCMFREALKTGFYDLQAARDEYRFSCGAGGMNHDLV 789


>tr|A5AFM3|A5AFM3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037862 PE=4 SV=1
Length = 1085

Score = 140 bits (354), Expect = 2e-32
Identities = 70/103 (67%), Positives = 84/103 (81%)
Frame = +1

Query: 1 GDLMDDANFVFETANSAILRLTKEITWMKEVLAAEQSLRKEPPTLFADRVFQNEINFSVH 180
GD +DDANFVFETAN+AILRLTKE++WM+EVL AE SLR + +AD+VF NEIN +V
Sbjct: 747 GDGVDDANFVFETANAAILRLTKELSWMEEVLEAEASLRTGALSTYADQVFANEINIAVT 806

Query: 181 VTEQNDESMMFRDALKTGLYDLQTARDEYRLSCGAIGMNGDLI 309
+TEQ+ + MFR+ALKTG YDLQ ARDEYR SCGA GMN DL+
Sbjct: 807 LTEQHYRNCMFREALKTGFYDLQAARDEYRFSCGAGGMNHDLV 849