BP921327
Clone id YMU001_000148_E04
Library
Length 457
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000148_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TAGAAAGTCTGTTTTAATAGAAAAAAAGTATTGGGCAGCACACTGCGATCTTCGGCAAAC
TCATAAAAGCTAGTTGCTTGTGCTTCAATGTTAACACATAACTTTAGAGCCCAGTTTCAA
AATTGCAAAGGTAATCAAACACAAAATCTAGAAGGTTCGAACAGAACCTCTGCAAAATTT
TCCTTCATAAATGGAATCTCTCTCTACATCCATCAGAACCACAGCCTCGAAAATGTAACA
TGCAGAGTCCAGACTCCAGTGGACTAATGACTTTTCAGGTACTCTTGGACGACATTCAGA
CCCTCTGTCTCTTCTCCATAGTCCTTTACAACAACACAGGAGCAGCCAACAACCTTCCGC
GCCTTTCCTTCGGAATCAATCTTACAAAGCCCGGCCCATTCACCAAGCTTTTTGGCACTG
GGAACTGAAATTAGGTTGACATTGTGCTCAGAGCACA
■■Homology search results ■■ -
sp_hit_id Q9XHS0
Definition sp|Q9XHS0|RS12_HORVU 40S ribosomal protein S12 OS=Hordeum vulgare
Align length 62
Score (bit) 117.0
E-value 2.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921327|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_E04.
(457 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9XHS0|RS12_HORVU 40S ribosomal protein S12 OS=Hordeum vulgar... 117 2e-26
sp|Q9SKZ3|RS122_ARATH 40S ribosomal protein S12-2 OS=Arabidopsis... 102 8e-22
sp|Q9S9P1|RS121_ARATH 40S ribosomal protein S12-1 OS=Arabidopsis... 99 7e-21
sp|O13019|RS12_ORENI 40S ribosomal protein S12 OS=Oreochromis ni... 99 9e-21
sp|P46405|RS12_PIG 40S ribosomal protein S12 OS=Sus scrofa GN=RP... 97 3e-20
sp|P25398|RS12_HUMAN 40S ribosomal protein S12 OS=Homo sapiens G... 97 3e-20
sp|P84175|RS12_CHICK 40S ribosomal protein S12 OS=Gallus gallus ... 97 3e-20
sp|Q76I81|RS12_BOVIN 40S ribosomal protein S12 OS=Bos taurus GN=... 97 3e-20
sp|Q9SMI3|RS12_CYAPA 40S ribosomal protein S12 OS=Cyanophora par... 95 1e-19
sp|P63324|RS12_RAT 40S ribosomal protein S12 OS=Rattus norvegicu... 94 3e-19
sp|P63323|RS12_MOUSE 40S ribosomal protein S12 OS=Mus musculus G... 94 3e-19
sp|P47840|RS12_XENLA 40S ribosomal protein S12 OS=Xenopus laevis... 94 4e-19
sp|P80455|RS12_DROME 40S ribosomal protein S12 OS=Drosophila mel... 91 3e-18
sp|O59936|RS12_ERYGR 40S ribosomal protein S12 OS=Erysiphe grami... 82 1e-15
sp|Q54PX9|RS12_DICDI 40S ribosomal protein S12 OS=Dictyostelium ... 73 7e-13
sp|O14062|RS12A_SCHPO 40S ribosomal protein S12-A OS=Schizosacch... 72 9e-13
sp|P49196|RS12_CAEEL 40S ribosomal protein S12 OS=Caenorhabditis... 72 1e-12
sp|P48589|RS12_YEAST 40S ribosomal protein S12 OS=Saccharomyces ... 71 2e-12
sp|O74322|RS12B_SCHPO 40S ribosomal protein S12-B OS=Schizosacch... 71 3e-12
sp|Q03253|RS12_TRYBB 40S ribosomal protein S12 OS=Trypanosoma br... 59 1e-08
sp|O97249|RS12_PLAF7 40S ribosomal protein S12 OS=Plasmodium fal... 57 3e-08
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cere... 31 2.9
sp|Q5JGR3|RL7A_PYRKO 50S ribosomal protein L7Ae OS=Pyrococcus ko... 29 8.4

>sp|Q9XHS0|RS12_HORVU 40S ribosomal protein S12 OS=Hordeum vulgare
GN=RPS12 PE=2 SV=1
Length = 143

Score = 117 bits (294), Expect = 2e-26
Identities = 51/62 (82%), Positives = 61/62 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNV+L++VPSAK LGEWAGLCKID+EGKARKVVGCSC+VVKDYGEE+EGLN+VQ+Y+
Sbjct: 81 CAEHNVHLVTVPSAKTLGEWAGLCKIDTEGKARKVVGCSCIVVKDYGEESEGLNIVQQYV 140

Query: 275 KS 270
KS
Sbjct: 141 KS 142


>sp|Q9SKZ3|RS122_ARATH 40S ribosomal protein S12-2 OS=Arabidopsis
thaliana GN=RPS12C PE=2 SV=1
Length = 144

Score = 102 bits (254), Expect = 8e-22
Identities = 43/63 (68%), Positives = 57/63 (90%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C++H++ L++VPSAK LGEWAGLCKIDSEG ARKVVGCSC+V+KD+GEET LN+V+++L
Sbjct: 82 CADHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHL 141

Query: 275 KSH 267
S+
Sbjct: 142 DSN 144


>sp|Q9S9P1|RS121_ARATH 40S ribosomal protein S12-1 OS=Arabidopsis
thaliana GN=RPS12A PE=2 SV=1
Length = 144

Score = 99.4 bits (246), Expect = 7e-21
Identities = 43/62 (69%), Positives = 54/62 (87%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C++H V L++VPSAK LGEWAGLCKIDSEG ARKVVGCSC+VVKD+GEET L++V +++
Sbjct: 82 CADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSIVNKHI 141

Query: 275 KS 270
S
Sbjct: 142 AS 143


>sp|O13019|RS12_ORENI 40S ribosomal protein S12 OS=Oreochromis
niloticus GN=rps12 PE=2 SV=3
Length = 132

Score = 99.0 bits (245), Expect = 9e-21
Identities = 43/62 (69%), Positives = 51/62 (82%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY
Sbjct: 69 CAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYF 128

Query: 275 KS 270
KS
Sbjct: 129 KS 130


>sp|P46405|RS12_PIG 40S ribosomal protein S12 OS=Sus scrofa GN=RPS12
PE=2 SV=2
Length = 132

Score = 97.4 bits (241), Expect = 3e-20
Identities = 42/61 (68%), Positives = 50/61 (81%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY
Sbjct: 69 CAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYF 128

Query: 275 K 273
K
Sbjct: 129 K 129


>sp|P25398|RS12_HUMAN 40S ribosomal protein S12 OS=Homo sapiens
GN=RPS12 PE=1 SV=3
Length = 132

Score = 97.4 bits (241), Expect = 3e-20
Identities = 42/61 (68%), Positives = 50/61 (81%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY
Sbjct: 69 CAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYF 128

Query: 275 K 273
K
Sbjct: 129 K 129


>sp|P84175|RS12_CHICK 40S ribosomal protein S12 OS=Gallus gallus
GN=RPS12 PE=1 SV=2
Length = 132

Score = 97.4 bits (241), Expect = 3e-20
Identities = 42/61 (68%), Positives = 50/61 (81%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY
Sbjct: 69 CAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYF 128

Query: 275 K 273
K
Sbjct: 129 K 129


>sp|Q76I81|RS12_BOVIN 40S ribosomal protein S12 OS=Bos taurus
GN=RPS12 PE=2 SV=1
Length = 132

Score = 97.4 bits (241), Expect = 3e-20
Identities = 42/61 (68%), Positives = 50/61 (81%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY
Sbjct: 69 CAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYF 128

Query: 275 K 273
K
Sbjct: 129 K 129


>sp|Q9SMI3|RS12_CYAPA 40S ribosomal protein S12 OS=Cyanophora
paradoxa GN=RPS12 PE=2 SV=1
Length = 136

Score = 95.1 bits (235), Expect = 1e-19
Identities = 41/61 (67%), Positives = 48/61 (78%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EH +NLI VP K+LGEW GLCKID EGKARKVVGCSC V+ +GEE+E V+ EYL
Sbjct: 74 CAEHGINLIKVPENKQLGEWVGLCKIDKEGKARKVVGCSCAVITKFGEESEARQVLMEYL 133

Query: 275 K 273
K
Sbjct: 134 K 134


>sp|P63324|RS12_RAT 40S ribosomal protein S12 OS=Rattus norvegicus
GN=Rps12 PE=1 SV=2
Length = 132

Score = 94.0 bits (232), Expect = 3e-19
Identities = 41/60 (68%), Positives = 49/60 (81%)
Frame = -3

Query: 452 SEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYLK 273
+EH +NLI V KKLGEW GLCKID EGK RKVVGCSCVVVKDYG+E++ +V++EY K
Sbjct: 70 AEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFK 129


tr_hit_id A9NQ79
Definition tr|A9NQ79|A9NQ79_PICSI 40S ribosomal protein S12 OS=Picea sitchensis
Align length 63
Score (bit) 129.0
E-value 6.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921327|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_E04.
(457 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NQ79|A9NQ79_PICSI 40S ribosomal protein S12 OS=Picea sitche... 129 6e-29
tr|A9NPA9|A9NPA9_PICSI 40S ribosomal protein S12 OS=Picea sitche... 128 1e-28
tr|B8LNN0|B8LNN0_PICSI Putative uncharacterized protein OS=Picea... 127 2e-28
tr|A9TAH6|A9TAH6_PHYPA 40S ribosomal protein S12 OS=Physcomitrel... 125 8e-28
tr|A9RT00|A9RT00_PHYPA 40S ribosomal protein S12 (Fragment) OS=P... 125 1e-27
tr|A9U0N3|A9U0N3_PHYPA 40S ribosomal protein S12 OS=Physcomitrel... 124 2e-27
tr|B6SKZ9|B6SKZ9_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=... 123 4e-27
tr|B6SGF1|B6SGF1_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=... 123 4e-27
tr|Q6ZLP8|Q6ZLP8_ORYSJ 40S ribosomal protein S12 OS=Oryza sativa... 122 9e-27
tr|B8B7B6|B8B7B6_ORYSI Putative uncharacterized protein OS=Oryza... 122 9e-27
tr|B6SHY8|B6SHY8_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=... 122 9e-27
tr|B4FGC8|B4FGC8_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=... 122 9e-27
tr|B6TCB8|B6TCB8_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=... 121 2e-26
tr|Q8H2J8|Q8H2J8_ORYSJ 40S ribosomal protein S12 OS=Oryza sativa... 120 3e-26
tr|A2YJM2|A2YJM2_ORYSI 40S ribosomal protein S12 OS=Oryza sativa... 119 1e-25
tr|A7PFT0|A7PFT0_VITVI 40S ribosomal protein S12 OS=Vitis vinife... 116 5e-25
tr|A9P9K3|A9P9K3_POPTR 40S ribosomal protein S12 OS=Populus tric... 113 4e-24
tr|A9PJY6|A9PJY6_POPJC 40S ribosomal protein S12 OS=Populus jack... 111 2e-23
tr|A9PDC2|A9PDC2_POPTR 40S ribosomal protein S12 OS=Populus tric... 111 2e-23
tr|A9P9I0|A9P9I0_POPTR 40S ribosomal protein S12 OS=Populus tric... 111 2e-23
tr|A8J9T0|A8J9T0_CHLRE 40S ribosomal protein S12 OS=Chlamydomona... 105 9e-22
tr|A8UFV4|A8UFV4_9ANNE 40S ribosomal protein S12 OS=Eurythoe com... 103 3e-21
tr|Q8T9N6|Q8T9N6_BRABE 40S ribosomal protein S12 OS=Branchiostom... 102 7e-21
tr|Q8ISP4|Q8ISP4_BRABE 40S ribosomal protein S12 OS=Branchiostom... 102 7e-21
tr|B6PNC4|B6PNC4_BRAFL Putative uncharacterized protein OS=Branc... 102 7e-21
tr|Q86PL3|Q86PL3_PERAI 40S ribosomal protein S12 OS=Perinereis a... 101 2e-20
tr|Q86FP6|Q86FP6_DERVA 40S ribosomal protein S12 OS=Dermacentor ... 100 3e-20
tr|B7PD38|B7PD38_IXOSC 40S ribosomal protein S12, putative OS=Ix... 100 3e-20
tr|A6N9Z9|A6N9Z9_ORNPR 40S ribosomal protein S12 OS=Ornithodoros... 100 4e-20
tr|B0Z9Q4|B0Z9Q4_9BILA 40S ribosomal protein S12 OS=Lineus virid... 100 5e-20

>tr|A9NQ79|A9NQ79_PICSI 40S ribosomal protein S12 OS=Picea
sitchensis PE=2 SV=1
Length = 141

Score = 129 bits (325), Expect = 6e-29
Identities = 59/63 (93%), Positives = 63/63 (100%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNV+QEY+
Sbjct: 79 CAEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVIQEYV 138

Query: 275 KSH 267
K+H
Sbjct: 139 KTH 141


>tr|A9NPA9|A9NPA9_PICSI 40S ribosomal protein S12 OS=Picea
sitchensis PE=3 SV=1
Length = 120

Score = 128 bits (322), Expect = 1e-28
Identities = 58/63 (92%), Positives = 63/63 (100%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSC+VVKDYGEETEGLNV+QEY+
Sbjct: 58 CAEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCLVVKDYGEETEGLNVIQEYV 117

Query: 275 KSH 267
K+H
Sbjct: 118 KTH 120


>tr|B8LNN0|B8LNN0_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 141

Score = 127 bits (320), Expect = 2e-28
Identities = 58/63 (92%), Positives = 62/63 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSC VVKDYGEETEGLNV+QEY+
Sbjct: 79 CAEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCFVVKDYGEETEGLNVIQEYV 138

Query: 275 KSH 267
K+H
Sbjct: 139 KTH 141


>tr|A9TAH6|A9TAH6_PHYPA 40S ribosomal protein S12 OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_142612 PE=3 SV=1
Length = 139

Score = 125 bits (315), Expect = 8e-28
Identities = 58/62 (93%), Positives = 61/62 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C EHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLN+V+EY+
Sbjct: 77 CQEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNIVREYV 136

Query: 275 KS 270
KS
Sbjct: 137 KS 138


>tr|A9RT00|A9RT00_PHYPA 40S ribosomal protein S12 (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_49325 PE=3 SV=1
Length = 132

Score = 125 bits (314), Expect = 1e-27
Identities = 58/62 (93%), Positives = 61/62 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C EHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVV+EY+
Sbjct: 71 CQEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVREYI 130

Query: 275 KS 270
K+
Sbjct: 131 KN 132


>tr|A9U0N3|A9U0N3_PHYPA 40S ribosomal protein S12 OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_109134 PE=3 SV=1
Length = 143

Score = 124 bits (311), Expect = 2e-27
Identities = 57/62 (91%), Positives = 60/62 (96%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C EHNVNL+SVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVV+EY
Sbjct: 81 CQEHNVNLVSVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVREYF 140

Query: 275 KS 270
K+
Sbjct: 141 KN 142


>tr|B6SKZ9|B6SKZ9_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=2
SV=1
Length = 140

Score = 123 bits (309), Expect = 4e-27
Identities = 55/63 (87%), Positives = 62/63 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNV+L++VPSAK LGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEE+EGLN+VQEY+
Sbjct: 78 CAEHNVHLVTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQEYV 137

Query: 275 KSH 267
KSH
Sbjct: 138 KSH 140


>tr|B6SGF1|B6SGF1_MAIZE 40S ribosomal protein S12 OS=Zea mays PE=2
SV=1
Length = 140

Score = 123 bits (309), Expect = 4e-27
Identities = 55/63 (87%), Positives = 62/63 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
CSEHNV+L++VPSAK LGEW+GLCKIDSEGKARKVVGCSCVVVKDYGEE+EGLN+VQEY+
Sbjct: 78 CSEHNVHLVTVPSAKTLGEWSGLCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQEYV 137

Query: 275 KSH 267
KSH
Sbjct: 138 KSH 140


>tr|Q6ZLP8|Q6ZLP8_ORYSJ 40S ribosomal protein S12 OS=Oryza sativa
subsp. japonica GN=OJ1027_G06.23 PE=2 SV=1
Length = 138

Score = 122 bits (306), Expect = 9e-27
Identities = 54/63 (85%), Positives = 62/63 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNV+L++VPSAK LGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEE+EGLN+VQ+Y+
Sbjct: 76 CAEHNVHLVTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQDYV 135

Query: 275 KSH 267
KSH
Sbjct: 136 KSH 138


>tr|B8B7B6|B8B7B6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24909 PE=4 SV=1
Length = 138

Score = 122 bits (306), Expect = 9e-27
Identities = 54/63 (85%), Positives = 62/63 (98%)
Frame = -3

Query: 455 CSEHNVNLISVPSAKKLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEETEGLNVVQEYL 276
C+EHNV+L++VPSAK LGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEE+EGLN+VQ+Y+
Sbjct: 76 CAEHNVHLVTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVKDYGEESEGLNIVQDYV 135

Query: 275 KSH 267
KSH
Sbjct: 136 KSH 138