BP921361
Clone id YMU001_000148_H10
Library
Length 389
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000148_H10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGTGATCACCATGACACCATACCCATCATCCACCTTGCCACCTGAGAGTAGATATGGTG
ACTTATGACTTACATGTATAGGCTCACTCTCACCTGTCAAAGACGATTGGTTTATGTATA
AAGGGTGCCCACCCACAAGCAGACCATTTGCTGGTACTTGATCTCCAATCTTGAGAAACA
CTATGTCCCCAACCACTAATTCGAATATGGAGATTTGCTTCCTTCTCCCTCCTCTGATTA
CCTCAACCGGAATATTCCTTTTCTCTTCATTCAGTACTGAAAACTGAAGTGATTGCCTGT
AGTCAGTAATGGACGTCACCAAAATGACAATTAACATAGCAACTGCAATGCTGACCCCAT
CATACCAACCCTCTTTAACACCATGAGTT
■■Homology search results ■■ -
sp_hit_id Q9LU41
Definition sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana
Align length 129
Score (bit) 166.0
E-value 3.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921361|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_H10.
(389 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membr... 166 3e-41
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membr... 160 2e-39
sp|Q9SZR1|ACA10_ARATH Putative calcium-transporting ATPase 10, p... 159 3e-39
sp|Q9LY77|ACA12_ARATH Putative calcium-transporting ATPase 12, p... 147 2e-35
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, pla... 145 8e-35
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, pla... 145 8e-35
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membr... 143 2e-34
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, p... 143 3e-34
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, p... 142 5e-34
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membr... 139 3e-33
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membr... 138 1e-32
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membr... 137 2e-32
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, pla... 135 6e-32
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplasti... 133 3e-31
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membr... 127 1e-29
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, pla... 120 2e-27
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyos... 112 8e-25
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase ... 96 4e-20
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPas... 96 4e-20
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPas... 96 7e-20
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosacc... 95 1e-19
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase ... 95 1e-19
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPas... 95 1e-19
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase ... 95 1e-19
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPas... 95 1e-19
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase ... 95 1e-19
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPas... 95 1e-19
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase ... 93 4e-19
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPas... 92 6e-19
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPas... 92 8e-19

>sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma
membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2
Length = 1086

Score = 166 bits (421), Expect = 3e-41
Identities = 79/129 (61%), Positives = 108/129 (83%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGW DG SIA A+L+VI+VT+++DYRQSLQF LN+EKRNI +EV+RGGR +IS
Sbjct: 225 TEGLKEGWLDGGSIAFAVLLVIVVTAVSDYRQSLQFQNLNDEKRNIQLEVMRGGRTVKIS 284

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I+++VVGD++ L+IGDQVPA+G+L+ GH L I++SS+TGES+ +H KSP+L+SG KV
Sbjct: 285 IYDVVVGDVIPLRIGDQVPADGVLISGHSLAIDESSMTGESKIVHKDQKSPFLMSGCKVA 344

Query: 28 DGYGVMVIT 2
DG G M++T
Sbjct: 345 DGVGNMLVT 353


>sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma
membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1
Length = 1074

Score = 160 bits (404), Expect = 2e-39
Identities = 75/130 (57%), Positives = 110/130 (84%), Gaps = 1/130 (0%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+++VI+VT+++DY+QSLQF LN+EKRNI +EV+RGGRR +IS
Sbjct: 211 TEGIKEGWYDGGSIAFAVILVIVVTAVSDYKQSLQFQNLNDEKRNIHLEVLRGGRRVEIS 270

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHV-SHKSPYLLSGGKV 32
I+++VVGD++ L IG+QVPA+G+L+ GH L +++SS+TGES+ ++ ++K P+L+SG KV
Sbjct: 271 IYDIVVGDVIPLNIGNQVPADGVLISGHSLALDESSMTGESKIVNKDANKDPFLMSGCKV 330

Query: 31 DDGYGVMVIT 2
DG G M++T
Sbjct: 331 ADGNGSMLVT 340


>sp|Q9SZR1|ACA10_ARATH Putative calcium-transporting ATPase 10,
plasma membrane-type OS=Arabidopsis thaliana GN=ACA10
PE=1 SV=2
Length = 1069

Score = 159 bits (403), Expect = 3e-39
Identities = 78/130 (60%), Positives = 106/130 (81%), Gaps = 1/130 (0%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+++GWYDG+SIA A+L+VI+VT+ +DYRQSLQF LNEEKRNI +EV R GRR +IS
Sbjct: 211 TEGIEKGWYDGISIAFAVLLVIVVTATSDYRQSLQFQNLNEEKRNIRLEVTRDGRRVEIS 270

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHV-SHKSPYLLSGGKV 32
I+++VVGD++ L IGDQVPA+G+LV GH L +++SS+TGES+ + S K P+L+SG KV
Sbjct: 271 IYDIVVGDVIPLNIGDQVPADGVLVAGHSLAVDESSMTGESKIVQKNSTKHPFLMSGCKV 330

Query: 31 DDGYGVMVIT 2
DG G M++T
Sbjct: 331 ADGNGTMLVT 340


>sp|Q9LY77|ACA12_ARATH Putative calcium-transporting ATPase 12,
plasma membrane-type OS=Arabidopsis thaliana GN=ACA12
PE=2 SV=1
Length = 1033

Score = 147 bits (371), Expect = 2e-35
Identities = 68/128 (53%), Positives = 101/128 (78%), Gaps = 1/128 (0%)
Frame = -2

Query: 385 HGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQISI 206
HG+KEGWY+G SI VA+ +VI+V++++++RQ QF L++ NI VEV+R RR+ ISI
Sbjct: 184 HGIKEGWYEGGSIFVAVFLVIVVSALSNFRQERQFDKLSKISNNIKVEVLRDSRRQHISI 243

Query: 205 FELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHK-SPYLLSGGKVD 29
F++VVGD+VFLKIGDQ+PA+GL + GH L +++SS+TGES+ + V HK +P+L SG K+
Sbjct: 244 FDVVVGDVVFLKIGDQIPADGLFLEGHSLQVDESSMTGESDHLEVDHKDNPFLFSGTKIV 303

Query: 28 DGYGVMVI 5
DG+ M++
Sbjct: 304 DGFAQMLV 311


>sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma
membrane-type OS=Oryza sativa subsp. japonica
GN=Os11g0140400 PE=3 SV=1
Length = 1017

Score = 145 bits (365), Expect = 8e-35
Identities = 67/129 (51%), Positives = 100/129 (77%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G +G YDG+ I +++ +V++VT+++DY+QSLQF L+ EK+ I + V R GRR++IS
Sbjct: 171 TEGWPKGMYDGLGIILSIFLVVMVTAVSDYKQSLQFKELDNEKKKIFIHVTRDGRRQKIS 230

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I++LVVGDIV L IGDQVPA+GL + G+ L I++SSL+GES+P++VS P++L+G KV
Sbjct: 231 IYDLVVGDIVHLSIGDQVPADGLYIHGYSLLIDESSLSGESDPVYVSQDKPFILAGTKVQ 290

Query: 28 DGYGVMVIT 2
DG M++T
Sbjct: 291 DGSAKMIVT 299


>sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma
membrane-type OS=Oryza sativa subsp. japonica
GN=Os12g0136900 PE=3 SV=1
Length = 1039

Score = 145 bits (365), Expect = 8e-35
Identities = 67/129 (51%), Positives = 100/129 (77%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G +G YDG+ I +++ +V++VT+++DY+QSLQF L+ EK+ I + V R GRR++IS
Sbjct: 193 TEGWPKGMYDGLGIILSIFLVVMVTAVSDYKQSLQFKELDNEKKKIFIHVTRDGRRQKIS 252

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I++LVVGDIV L IGDQVPA+GL + G+ L I++SSL+GES+P++VS P++L+G KV
Sbjct: 253 IYDLVVGDIVHLSIGDQVPADGLYIHGYSLLIDESSLSGESDPVYVSQDKPFILAGTKVQ 312

Query: 28 DGYGVMVIT 2
DG M++T
Sbjct: 313 DGSAKMIVT 321


>sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma
membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=2 SV=1
Length = 1030

Score = 143 bits (361), Expect = 2e-34
Identities = 69/129 (53%), Positives = 98/129 (75%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G G YDG I +++L+V++VT+I+DY+QSLQF L+ EK+ I V+V R G R++IS
Sbjct: 188 TEGFPRGMYDGTGILLSILLVVMVTAISDYKQSLQFRDLDREKKKIIVQVTRDGSRQEIS 247

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I +LVVGD+V L IGDQVPA+G+ + G+ L I++SSL+GESEP HV+ + P+LLSG KV
Sbjct: 248 IHDLVVGDVVHLSIGDQVPADGIFISGYNLEIDESSLSGESEPSHVNKEKPFLLSGTKVQ 307

Query: 28 DGYGVMVIT 2
+G M++T
Sbjct: 308 NGSAKMLVT 316


>sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13,
plasma membrane-type OS=Arabidopsis thaliana GN=ACA13
PE=2 SV=1
Length = 1017

Score = 143 bits (360), Expect = 3e-34
Identities = 67/129 (51%), Positives = 101/129 (78%), Gaps = 1/129 (0%)
Frame = -2

Query: 385 HGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQISI 206
HG+KEGWYDG SI VA+ +V+ V++++++RQ+ QF L++ NI ++V+R GRR++ISI
Sbjct: 179 HGLKEGWYDGGSIFVAVFLVVAVSAVSNFRQNRQFDKLSKVSSNIKIDVVRNGRRQEISI 238

Query: 205 FELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVS-HKSPYLLSGGKVD 29
F++VVGDIV L IGDQVPA+G+ V GH L++++SS+TGES+ + VS + +L SG K+
Sbjct: 239 FDIVVGDIVCLNIGDQVPADGVFVEGHLLHVDESSMTGESDHVEVSLTGNTFLFSGTKIA 298

Query: 28 DGYGVMVIT 2
DG+G M +T
Sbjct: 299 DGFGKMAVT 307


>sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11,
plasma membrane-type OS=Arabidopsis thaliana GN=ACA11
PE=2 SV=1
Length = 1025

Score = 142 bits (358), Expect = 5e-34
Identities = 66/129 (51%), Positives = 99/129 (76%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G +G YDG I +++++V++VT+I+DY+QSLQF L+ EK+ I ++V R G R+++S
Sbjct: 188 TEGFPKGMYDGTGILLSIILVVMVTAISDYKQSLQFRDLDREKKKIIIQVTRDGSRQEVS 247

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I +LVVGD+V L IGDQVPA+G+ + G+ L I++SSL+GESEP HV+ + P+LLSG KV
Sbjct: 248 IHDLVVGDVVHLSIGDQVPADGIFISGYNLEIDESSLSGESEPSHVNKEKPFLLSGTKVQ 307

Query: 28 DGYGVMVIT 2
+G M++T
Sbjct: 308 NGSAKMLVT 316


>sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma
membrane-type OS=Oryza sativa subsp. japonica
GN=Os01g0939100 PE=2 SV=1
Length = 1043

Score = 139 bits (351), Expect = 3e-33
Identities = 65/129 (50%), Positives = 97/129 (75%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G G YDGV I + +L+V+++T+ +DY+QSLQF L++EK+ I V+V R G R+++S
Sbjct: 196 TEGWPSGMYDGVGIMLTILLVVMITAASDYKQSLQFRDLDKEKKKIDVQVTRDGYRQKVS 255

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I+++VVGDIV L IGDQVPA+GL + G+ +++S+L+GESEP+HVS + +LL G KV
Sbjct: 256 IYDIVVGDIVHLSIGDQVPADGLFIDGYSFVVDESNLSGESEPVHVSTANRFLLGGTKVQ 315

Query: 28 DGYGVMVIT 2
DG M++T
Sbjct: 316 DGSARMLVT 324


tr_hit_id Q7XBH9
Definition tr|Q7XBH9|Q7XBH9_CERRI Calcium-transporting ATPase 1 OS=Ceratopteris richardii
Align length 129
Score (bit) 222.0
E-value 8.0e-57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921361|Adiantum capillus-veneris mRNA, clone:
YMU001_000148_H10.
(389 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7XBH9|Q7XBH9_CERRI Calcium-transporting ATPase 1 OS=Ceratopt... 222 8e-57
tr|Q0E3G0|Q0E3G0_ORYSJ Os02g0176700 protein OS=Oryza sativa subs... 179 5e-44
tr|B8AIL2|B8AIL2_ORYSI Putative uncharacterized protein OS=Oryza... 179 5e-44
tr|Q6ETP2|Q6ETP2_ORYSJ Putative calcium-transporting ATPase OS=O... 177 2e-43
tr|A3A3Q1|A3A3Q1_ORYSJ Putative uncharacterized protein OS=Oryza... 177 2e-43
tr|Q7X8B5|Q7X8B5_ORYSJ Os04g0605500 protein OS=Oryza sativa subs... 175 9e-43
tr|B8ATU2|B8ATU2_ORYSI Putative uncharacterized protein OS=Oryza... 175 9e-43
tr|A3AX64|A3AX64_ORYSJ Putative uncharacterized protein OS=Oryza... 175 9e-43
tr|A7PVP3|A7PVP3_VITVI Chromosome chr9 scaffold_33, whole genome... 173 3e-42
tr|A7QUB1|A7QUB1_VITVI Chromosome chr11 scaffold_177, whole geno... 171 1e-41
tr|Q7EZ84|Q7EZ84_ORYSJ Putative calcium-transporting ATPase 8, p... 170 3e-41
tr|B8B8W3|B8B8W3_ORYSI Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|A3BUV0|A3BUV0_ORYSJ Putative uncharacterized protein OS=Oryza... 170 3e-41
tr|A2Q409|A2Q409_MEDTR ATPase, E1-E2 type OS=Medicago truncatula... 166 7e-40
tr|Q70TF0|Q70TF0_PHYPA Calcium-dependent ATPase (Putative plasma... 161 2e-38
tr|A9RGV4|A9RGV4_PHYPA Predicted protein OS=Physcomitrella paten... 161 2e-38
tr|Q0WV19|Q0WV19_ARATH Ca2+-transporting ATPase like protein OS=... 160 4e-38
tr|A9SLT6|A9SLT6_PHYPA Predicted protein OS=Physcomitrella paten... 158 1e-37
tr|Q70TF1|Q70TF1_PHYPA Putative P-type II calcium ATPase OS=Phys... 156 4e-37
tr|A9TQN0|A9TQN0_PHYPA Predicted protein OS=Physcomitrella paten... 156 4e-37
tr|A7NWV3|A7NWV3_VITVI Chromosome chr5 scaffold_2, whole genome ... 152 1e-35
tr|A9RZJ8|A9RZJ8_PHYPA Predicted protein OS=Physcomitrella paten... 151 1e-35
tr|A7NWX3|A7NWX3_VITVI Chromosome chr5 scaffold_2, whole genome ... 151 2e-35
tr|A7NWX1|A7NWX1_VITVI Chromosome chr5 scaffold_2, whole genome ... 150 2e-35
tr|A7NWX0|A7NWX0_VITVI Chromosome chr5 scaffold_2, whole genome ... 150 3e-35
tr|A5B8H7|A5B8H7_VITVI Putative uncharacterized protein OS=Vitis... 150 4e-35
tr|A7Q1Z0|A7Q1Z0_VITVI Chromosome chr13 scaffold_45, whole genom... 149 5e-35
tr|A5BJ69|A5BJ69_VITVI Putative uncharacterized protein OS=Vitis... 149 5e-35
tr|A7NWW2|A7NWW2_VITVI Chromosome chr5 scaffold_2, whole genome ... 149 7e-35
tr|A7NWW5|A7NWW5_VITVI Chromosome chr5 scaffold_2, whole genome ... 148 1e-34

>tr|Q7XBH9|Q7XBH9_CERRI Calcium-transporting ATPase 1
OS=Ceratopteris richardii PE=2 SV=1
Length = 1086

Score = 222 bits (565), Expect = 8e-57
Identities = 110/129 (85%), Positives = 121/129 (93%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T GVK+GWYDGVSIAVA+LIVILVTSITDYRQSLQF+VL+EEKRNI VEVIRGGRRK +S
Sbjct: 219 TDGVKDGWYDGVSIAVAVLIVILVTSITDYRQSLQFTVLSEEKRNIRVEVIRGGRRKHVS 278

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
IF+LVVGDIVFLKIGDQVPA+GLLV GH LYINQSSLTGESEP+HVS ++PYLLSG KVD
Sbjct: 279 IFDLVVGDIVFLKIGDQVPADGLLVDGHSLYINQSSLTGESEPVHVSQRAPYLLSGSKVD 338

Query: 28 DGYGVMVIT 2
DGYG MV+T
Sbjct: 339 DGYGKMVVT 347


>tr|Q0E3G0|Q0E3G0_ORYSJ Os02g0176700 protein OS=Oryza sativa subsp.
japonica GN=Os02g0176700 PE=3 SV=1
Length = 1029

Score = 179 bits (455), Expect = 5e-44
Identities = 85/129 (65%), Positives = 109/129 (84%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+ +VILVT+++DY+QSLQF LNEEK+NI VEVIRGGRR ++S
Sbjct: 173 TEGIKEGWYDGASIAFAVFLVILVTAVSDYKQSLQFQHLNEEKQNIQVEVIRGGRRIEVS 232

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
IF++VVGD+V LKIGDQVPA+G+LV GH L I++SS+TGES+ + HKSP+L+ G KV
Sbjct: 233 IFDIVVGDVVALKIGDQVPADGVLVSGHSLAIDESSMTGESKIVVKDHKSPFLMGGCKVA 292

Query: 28 DGYGVMVIT 2
DGYG M++T
Sbjct: 293 DGYGTMLVT 301


>tr|B8AIL2|B8AIL2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06071 PE=4 SV=1
Length = 979

Score = 179 bits (455), Expect = 5e-44
Identities = 85/129 (65%), Positives = 109/129 (84%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+ +VILVT+++DY+QSLQF LNEEK+NI VEVIRGGRR ++S
Sbjct: 129 TEGIKEGWYDGASIAFAVFLVILVTAVSDYKQSLQFQHLNEEKQNIQVEVIRGGRRIEVS 188

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
IF++VVGD+V LKIGDQVPA+G+LV GH L I++SS+TGES+ + HKSP+L+ G KV
Sbjct: 189 IFDIVVGDVVALKIGDQVPADGVLVSGHSLAIDESSMTGESKIVVKDHKSPFLMGGCKVA 248

Query: 28 DGYGVMVIT 2
DGYG M++T
Sbjct: 249 DGYGTMLVT 257


>tr|Q6ETP2|Q6ETP2_ORYSJ Putative calcium-transporting ATPase
OS=Oryza sativa subsp. japonica GN=P0504A05.5 PE=3 SV=1
Length = 1057

Score = 177 bits (450), Expect = 2e-43
Identities = 84/127 (66%), Positives = 108/127 (85%)
Frame = -2

Query: 382 GVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQISIF 203
G+KEGWYDG SIA A+ +VILVT+++DY+QSLQF LNEEK+NI VEVIRGGRR ++SIF
Sbjct: 189 GIKEGWYDGASIAFAVFLVILVTAVSDYKQSLQFQHLNEEKQNIQVEVIRGGRRIEVSIF 248

Query: 202 ELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVDDG 23
++VVGD+V LKIGDQVPA+G+LV GH L I++SS+TGES+ + HKSP+L+ G KV DG
Sbjct: 249 DIVVGDVVALKIGDQVPADGVLVSGHSLAIDESSMTGESKIVVKDHKSPFLMGGCKVADG 308

Query: 22 YGVMVIT 2
YG M++T
Sbjct: 309 YGTMLVT 315


>tr|A3A3Q1|A3A3Q1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005423 PE=3 SV=1
Length = 967

Score = 177 bits (450), Expect = 2e-43
Identities = 84/127 (66%), Positives = 108/127 (85%)
Frame = -2

Query: 382 GVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQISIF 203
G+KEGWYDG SIA A+ +VILVT+++DY+QSLQF LNEEK+NI VEVIRGGRR ++SIF
Sbjct: 145 GIKEGWYDGASIAFAVFLVILVTAVSDYKQSLQFQHLNEEKQNIQVEVIRGGRRIEVSIF 204

Query: 202 ELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVDDG 23
++VVGD+V LKIGDQVPA+G+LV GH L I++SS+TGES+ + HKSP+L+ G KV DG
Sbjct: 205 DIVVGDVVALKIGDQVPADGVLVSGHSLAIDESSMTGESKIVVKDHKSPFLMGGCKVADG 264

Query: 22 YGVMVIT 2
YG M++T
Sbjct: 265 YGTMLVT 271


>tr|Q7X8B5|Q7X8B5_ORYSJ Os04g0605500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0035M09.2 PE=3 SV=2
Length = 1088

Score = 175 bits (444), Expect = 9e-43
Identities = 80/129 (62%), Positives = 108/129 (83%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+L+V++VT+ +DY+QSLQF LNEEK+NI +EV+RGGRR +S
Sbjct: 216 TEGIKEGWYDGASIAFAVLLVVVVTATSDYKQSLQFQNLNEEKQNIKLEVVRGGRRISVS 275

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I++LV GD+V LKIGDQVPA+G+L+ GH L +++SS+TGES+ +H KSP+L+SG KV
Sbjct: 276 IYDLVAGDVVPLKIGDQVPADGILISGHSLSVDESSMTGESKIVHKDQKSPFLMSGCKVA 335

Query: 28 DGYGVMVIT 2
DGYG M++T
Sbjct: 336 DGYGTMLVT 344


>tr|B8ATU2|B8ATU2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17291 PE=4 SV=1
Length = 1088

Score = 175 bits (444), Expect = 9e-43
Identities = 80/129 (62%), Positives = 108/129 (83%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+L+V++VT+ +DY+QSLQF LNEEK+NI +EV+RGGRR +S
Sbjct: 216 TEGIKEGWYDGASIAFAVLLVVVVTATSDYKQSLQFQNLNEEKQNIKLEVVRGGRRISVS 275

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I++LV GD+V LKIGDQVPA+G+L+ GH L +++SS+TGES+ +H KSP+L+SG KV
Sbjct: 276 IYDLVAGDVVPLKIGDQVPADGILISGHSLSVDESSMTGESKIVHKDQKSPFLMSGCKVA 335

Query: 28 DGYGVMVIT 2
DGYG M++T
Sbjct: 336 DGYGTMLVT 344


>tr|A3AX64|A3AX64_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_015386 PE=3 SV=1
Length = 1101

Score = 175 bits (444), Expect = 9e-43
Identities = 80/129 (62%), Positives = 108/129 (83%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+L+V++VT+ +DY+QSLQF LNEEK+NI +EV+RGGRR +S
Sbjct: 216 TEGIKEGWYDGASIAFAVLLVVVVTATSDYKQSLQFQNLNEEKQNIKLEVVRGGRRISVS 275

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
I++LV GD+V LKIGDQVPA+G+L+ GH L +++SS+TGES+ +H KSP+L+SG KV
Sbjct: 276 IYDLVAGDVVPLKIGDQVPADGILISGHSLSVDESSMTGESKIVHKDQKSPFLMSGCKVA 335

Query: 28 DGYGVMVIT 2
DGYG M++T
Sbjct: 336 DGYGTMLVT 344


>tr|A7PVP3|A7PVP3_VITVI Chromosome chr9 scaffold_33, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025300001
PE=3 SV=1
Length = 988

Score = 173 bits (439), Expect = 3e-42
Identities = 84/129 (65%), Positives = 107/129 (82%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T GVKEGWYDG SIA A+ +VI VT+I+DYRQSLQF LNEEKRNI ++VIRGGR +IS
Sbjct: 212 TEGVKEGWYDGGSIAFAVFLVIFVTAISDYRQSLQFQNLNEEKRNIHLKVIRGGRPVEIS 271

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
IF++VVGD+V L IGDQVPA+G+L+ GH L I++SS+TGES+ +H HK+P+L+SG KV
Sbjct: 272 IFDIVVGDVVPLSIGDQVPADGILITGHSLAIDESSMTGESKIVHKDHKAPFLMSGCKVA 331

Query: 28 DGYGVMVIT 2
DG G M++T
Sbjct: 332 DGVGTMLVT 340


>tr|A7QUB1|A7QUB1_VITVI Chromosome chr11 scaffold_177, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00006764001
PE=3 SV=1
Length = 688

Score = 171 bits (434), Expect = 1e-41
Identities = 78/129 (60%), Positives = 110/129 (85%)
Frame = -2

Query: 388 THGVKEGWYDGVSIAVAMLIVILVTSITDYRQSLQFSVLNEEKRNIPVEVIRGGRRKQIS 209
T G+KEGWYDG SIA A+++VI+VT+++DYRQSLQF LN+EKRNI +E+IRGGRR ++S
Sbjct: 216 TEGIKEGWYDGGSIAFAVILVIVVTAVSDYRQSLQFQSLNDEKRNIHMEIIRGGRRVEVS 275

Query: 208 IFELVVGDIVFLKIGDQVPANGLLVGGHPLYINQSSLTGESEPIHVSHKSPYLLSGGKVD 29
IF++VVGD+V L IG+QVPA+G+L+ GH L I++SS+TGES+ +H K+P+L++G KV
Sbjct: 276 IFDIVVGDVVPLNIGNQVPADGILISGHSLAIDESSMTGESKIVHKDSKAPFLMAGCKVA 335

Query: 28 DGYGVMVIT 2
DG G+M++T
Sbjct: 336 DGSGIMLVT 344