BP921385
Clone id YMU001_000149_C03
Library
Length 291
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000149_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTGCAAACACAACAAAGTGAACATACGTAAGGTAGAGTAGCCAGTAATGAGACATGCT
CCAGTAACAAGAAACACTAACCCCTTCTAATCACACAAGCATCCGTGAGTAGATGGCTGA
TGGGAGCTGGAGTGTTGAGCTCTGATTGGCTAGACCCAGTGTTCAATCCTGGTGAATTGT
TAAAGCTGTTCTGACGCAGCTGCATCTCTAATGCTTAAATGTTCCCATTTTGCCTTGAAT
ATCATGCTAATCCTTCATATAAACTGCACTCCAGTTCGCTTGAAGAGCATC
■■Homology search results ■■ -
sp_hit_id P65056
Definition sp|P65056|Y2948_MYCBO Uncharacterized protein Mb2948c OS=Mycobacterium bovis
Align length 38
Score (bit) 28.9
E-value 8.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921385|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_C03.
(291 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P65056|Y2948_MYCBO Uncharacterized protein Mb2948c OS=Mycobac... 29 8.2
sp|P65055|Y2923_MYCTU Uncharacterized protein Rv2923c/MT2992 OS=... 29 8.2

>sp|P65056|Y2948_MYCBO Uncharacterized protein Mb2948c
OS=Mycobacterium bovis GN=Mb2948c PE=4 SV=1
Length = 137

Score = 28.9 bits (63), Expect = 8.2
Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
Frame = +3

Query: 93 TQASVSRWLMGAGVL-SSDWLDPVFNPGELLKLF*RSC 203
T+ + R GA VL S+ +D VF PGELLK+ +C
Sbjct: 11 TRRYIGRSTRGAQVLVGSEDVDGVFTPGELLKIALAAC 48


>sp|P65055|Y2923_MYCTU Uncharacterized protein Rv2923c/MT2992
OS=Mycobacterium tuberculosis GN=Rv2923c PE=4 SV=1
Length = 137

Score = 28.9 bits (63), Expect = 8.2
Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
Frame = +3

Query: 93 TQASVSRWLMGAGVL-SSDWLDPVFNPGELLKLF*RSC 203
T+ + R GA VL S+ +D VF PGELLK+ +C
Sbjct: 11 TRRYIGRSTRGAQVLVGSEDVDGVFTPGELLKIALAAC 48


tr_hit_id A8NUX1
Definition tr|A8NUX1|A8NUX1_COPC7 Putative uncharacterized protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003)
Align length 32
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921385|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_C03.
(291 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8NUX1|A8NUX1_COPC7 Putative uncharacterized protein OS=Copri... 33 9.3

>tr|A8NUX1|A8NUX1_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_10047 PE=4 SV=1
Length = 622

Score = 32.7 bits (73), Expect = 9.3
Identities = 12/32 (37%), Positives = 22/32 (68%)
Frame = +3

Query: 84 LLITQASVSRWLMGAGVLSSDWLDPVFNPGEL 179
L + A+ WLMGA ++++ +DP+ NPG++
Sbjct: 12 LSLATAANGYWLMGADFITTERIDPIVNPGQV 43