BP921412
Clone id YMU001_000149_E09
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000149_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTACCTGCAGGTACTCTTCACTGACTCACTCCTCGAGGAATCGATGGAAGCAGAGTGCGC
AGCTTCCGCCTTCTCTTTGGCAGCTGAGAACCTCCTCTTGTGTACTGCCTCTGCTTCTTC
TAGTAGTTTATCAATAGATGTGTTGCAATTCTGGAAGGACATTCTTCCCAGTAACGCCCC
TGGTTTTGGATCTCCTTCCAGAATAACAGTACATCTTTTTCCAGCGGCCCGGGCAATGGC
AGGCACAACCCAGTGACCTTCATCAGCAACGGTTGCGTCTTCTTCTGCTTTTTTTGCAAC
TTCTTCCCTTTGCTTTGCTCTTTGCATAAACTGTCAAAGAAGCCAATTAGGTTCAAACCA
CAACTGCTCCTCAATCAATGTCGCGTTTAATGTGAACAAGAGGTTGCAGAAGCACCCCAT
CCTAAAAATTCTACATCCCCCTGCATCTTTACCCGCTCTGCCACATACTTCAGGTGCTGC
AAGCCATTCGAGTACTCGCGTTTCGC
■■Homology search results ■■ -
sp_hit_id Q99547
Definition sp|Q99547|MPH6_HUMAN M-phase phosphoprotein 6 OS=Homo sapiens
Align length 94
Score (bit) 38.5
E-value 0.018
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921412|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_E09.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q99547|MPH6_HUMAN M-phase phosphoprotein 6 OS=Homo sapiens GN... 39 0.018
sp|Q9D1Q1|MPH6_MOUSE M-phase phosphoprotein 6 OS=Mus musculus GN... 32 1.7
sp|Q5UPH7|YL107_MIMIV Putative BTB/POZ domain-containing protein... 31 2.9
sp|P83399|THGC1_VIGUN Cp-thionin-1 OS=Vigna unguiculata PE=1 SV=1 30 8.4
sp|Q9VXT5|C19L2_DROME CWF19-like protein 2 homolog OS=Drosophila... 30 8.4

>sp|Q99547|MPH6_HUMAN M-phase phosphoprotein 6 OS=Homo sapiens
GN=MPHOSPH6 PE=1 SV=1
Length = 160

Score = 38.5 bits (88), Expect = 0.018
Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
Frame = -3

Query: 372 EEQLWFEPNWLL*QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEG 193
E + N L +FMQR E + EE+ + E HW + + K +I E
Sbjct: 4 ERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLD-LPELKEKESFIIEEQ 62

Query: 192 DPK--PGALLGRMSFQNCNTSIDKLLEEAEAVHK 97
L GRMSF+ N ++KL+ + A HK
Sbjct: 63 SFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHK 96


>sp|Q9D1Q1|MPH6_MOUSE M-phase phosphoprotein 6 OS=Mus musculus
GN=Mphosph6 PE=2 SV=1
Length = 161

Score = 32.0 bits (71), Expect = 1.7
Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 2/86 (2%)
Frame = -3

Query: 372 EEQLWFEPNWLL*QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEG 193
E + N L +FMQR E + EE+ + + HW + + K ++ E
Sbjct: 4 ERKTKLSKNLLRMKFMQRGLDSETKKQLEEEERKMISDEHWYLD-LPELKEKESFIVEEQ 62

Query: 192 DPK--PGALLGRMSFQNCNTSIDKLL 121
L GRMSF+ N ++KL+
Sbjct: 63 SFSLCEDLLYGRMSFRGFNPEVEKLM 88


>sp|Q5UPH7|YL107_MIMIV Putative BTB/POZ domain-containing protein
L107 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L107
PE=3 SV=1
Length = 501

Score = 31.2 bits (69), Expect = 2.9
Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
Frame = +2

Query: 314 FALCINCQRSQLGSNHNCSSIN-VAFNVNKRLQK 412
F LCI+ R +L +NH+C SI V N N +L K
Sbjct: 173 FILCIDSDRIELHNNHSCFSIGPVKLNYNCKLYK 206


>sp|P83399|THGC1_VIGUN Cp-thionin-1 OS=Vigna unguiculata PE=1 SV=1
Length = 47

Score = 29.6 bits (65), Expect = 8.4
Identities = 12/23 (52%), Positives = 12/23 (52%)
Frame = -3

Query: 468 VCGRAGKDAGGCRIFRMGCFCNL 400
VC G G CR FR CFC L
Sbjct: 23 VCRNEGFSGGNCRGFRRRCFCTL 45


>sp|Q9VXT5|C19L2_DROME CWF19-like protein 2 homolog OS=Drosophila
melanogaster GN=CG9213 PE=1 SV=2
Length = 687

Score = 29.6 bits (65), Expect = 8.4
Identities = 12/37 (32%), Positives = 22/37 (59%)
Frame = -3

Query: 327 MQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGK 217
+Q+AK+R E+ + E + E W++PA+A+ K
Sbjct: 27 LQQAKERAELRGQRERQKELRGEADWMLPALAKKLEK 63


tr_hit_id A9TB75
Definition tr|A9TB75|A9TB75_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 79
Score (bit) 87.4
E-value 3.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921412|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_E09.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TB75|A9TB75_PHYPA Predicted protein OS=Physcomitrella paten... 87 3e-16
tr|A9NP18|A9NP18_PICSI Putative uncharacterized protein OS=Picea... 75 2e-12
tr|Q38JJ1|Q38JJ1_SOLTU Putative uncharacterized protein OS=Solan... 73 9e-12
tr|A7NYX7|A7NYX7_VITVI Chromosome chr6 scaffold_3, whole genome ... 68 2e-10
tr|B8AD83|B8AD83_ORYSI Putative uncharacterized protein OS=Oryza... 64 5e-09
tr|B6TZI4|B6TZI4_MAIZE Putative uncharacterized protein OS=Zea m... 62 1e-08
tr|Q9LTI4|Q9LTI4_ARATH Genomic DNA, chromosome 5, BAC clone:F2O1... 62 2e-08
tr|Q8LD59|Q8LD59_ARATH Putative uncharacterized protein OS=Arabi... 61 3e-08
tr|Q5ZBL4|Q5ZBL4_ORYSJ cDNA clone:006-309-E03, full insert seque... 61 3e-08
tr|B6LWH1|B6LWH1_BRAFL Putative uncharacterized protein OS=Branc... 45 0.003
tr|B6P8Y3|B6P8Y3_BRAFL Putative uncharacterized protein OS=Branc... 44 0.004
tr|Q53HB4|Q53HB4_HUMAN M-phase phosphoprotein 6 variant (Fragmen... 39 0.19
tr|Q6DDD4|Q6DDD4_XENTR LOC447969 protein (Fragment) OS=Xenopus t... 37 0.54
tr|Q28IZ6|Q28IZ6_XENTR M-phase phosphoprotein 6 OS=Xenopus tropi... 37 0.54
tr|B1WAT9|B1WAT9_XENTR M-phase phosphoprotein 6 OS=Xenopus tropi... 37 0.54
tr|Q2NLB2|Q2NLB2_XENLA MGC130899 protein OS=Xenopus laevis GN=MG... 35 2.7
tr|B5XE73|B5XE73_SALSA M-phase phosphoprotein 6 OS=Salmo salar G... 35 2.7
tr|B5XB22|B5XB22_SALSA M-phase phosphoprotein 6 OS=Salmo salar G... 35 2.7
tr|Q2TBI9|Q2TBI9_BOVIN M-phase phosphoprotein 6 OS=Bos taurus GN... 34 3.5
tr|Q6DBY4|Q6DBY4_DANRE Zgc:100960 OS=Danio rerio GN=zgc:100960 P... 34 4.6
tr|A2SNS8|A2SNS8_METPP Precorrin-6Y C5,15-methyltransferase (Dec... 34 4.6
tr|B0CPJ5|B0CPJ5_LACBS Predicted protein OS=Laccaria bicolor (st... 34 4.6
tr|A7SGT0|A7SGT0_NEMVE Predicted protein OS=Nematostella vectens... 33 6.0
tr|Q9KE87|Q9KE87_BACHD SNF2 helicase OS=Bacillus halodurans GN=B... 33 7.8

>tr|A9TB75|A9TB75_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_90482 PE=4 SV=1
Length = 376

Score = 87.4 bits (215), Expect = 3e-16
Identities = 43/79 (54%), Positives = 56/79 (70%), Gaps = 3/79 (3%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDAT---VADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGR 163
+FMQRAK RE+ K+ E +A D+ HWV PA A+ RC VI EGDPKPGA++GR
Sbjct: 19 RFMQRAKIREDELKRQEAEAAGSAAVDDSHWVTPA---ASASRCKVIFEGDPKPGAIIGR 75

Query: 162 MSFQNCNTSIDKLLEEAEA 106
MSFQ+ N S+D+++EE EA
Sbjct: 76 MSFQSFNPSVDRIVEEVEA 94


>tr|A9NP18|A9NP18_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 180

Score = 74.7 bits (182), Expect = 2e-12
Identities = 37/77 (48%), Positives = 52/77 (67%), Gaps = 1/77 (1%)
Frame = -3

Query: 330 FMQRAKQREEVAKKAEEDATVADE-GHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
FMQR++Q+EE KK E++ ++ + G+W +C VI+EGDP PGA++GRMSF
Sbjct: 12 FMQRSRQKEESVKKEEQEQVISPKSGNW-----------KCVVIMEGDPTPGAVIGRMSF 60

Query: 153 QNCNTSIDKLLEEAEAV 103
QN N SIDKL +E E +
Sbjct: 61 QNFNPSIDKLSDEVEDI 77


>tr|Q38JJ1|Q38JJ1_SOLTU Putative uncharacterized protein OS=Solanum
tuberosum PE=2 SV=1
Length = 186

Score = 72.8 bits (177), Expect = 9e-12
Identities = 41/74 (55%), Positives = 50/74 (67%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
+FMQRA REE KK EE V +G++ + +A KRC +I+EGDP PGA+ GRMSF
Sbjct: 14 KFMQRASLREEKPKKEEE---VVPDGNFP----SSSAPKRCVIIMEGDPHPGAIKGRMSF 66

Query: 153 QNCNTSIDKLLEEA 112
Q N SIDKL EEA
Sbjct: 67 QGFNPSIDKLSEEA 80


>tr|A7NYX7|A7NYX7_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024292001
PE=4 SV=1
Length = 186

Score = 68.2 bits (165), Expect = 2e-10
Identities = 38/74 (51%), Positives = 49/74 (66%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
+FMQRA Q+EE +KK EE V E ++ P + ++C VI+EGDP PGA GRMSF
Sbjct: 14 KFMQRANQKEEKSKKEEE---VKPEDNFFSPNTVK---RKCVVIVEGDPHPGATKGRMSF 67

Query: 153 QNCNTSIDKLLEEA 112
QN N +IDKL + A
Sbjct: 68 QNFNPAIDKLNDAA 81


>tr|B8AD83|B8AD83_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00363 PE=4 SV=1
Length = 199

Score = 63.5 bits (153), Expect = 5e-09
Identities = 37/84 (44%), Positives = 52/84 (61%), Gaps = 5/84 (5%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWV-VPAIARAAG----KRCTVILEGDPKPGALL 169
+FMQRA ++V +K + +A A+E V VP+ + ++C VI+EG+P PGA
Sbjct: 15 KFMQRAAVAQKVEEKPKVEAAAAEEEEVVTVPSGGVGSSVKVTRKCVVIMEGNPHPGAAK 74

Query: 168 GRMSFQNCNTSIDKLLEEAEAVHK 97
GRMSF N N SIDKL +EA H+
Sbjct: 75 GRMSFLNFNPSIDKLTQEATGGHQ 98


>tr|B6TZI4|B6TZI4_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 191

Score = 62.4 bits (150), Expect = 1e-08
Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAG----KRCTVILEGDPKPGALLG 166
+FMQR ++ +KAE + V +E + P+ A+ ++C VI+EG+P PGA+ G
Sbjct: 15 KFMQRGAAAQKAEEKAEVE--VQEEAVVMAPSGGFASSAQVVRKCIVIMEGNPHPGAIKG 72

Query: 165 RMSFQNCNTSIDKLLEEA 112
RMSFQN N SIDKL EEA
Sbjct: 73 RMSFQNFNPSIDKLNEEA 90


>tr|Q9LTI4|Q9LTI4_ARATH Genomic DNA, chromosome 5, BAC clone:F2O15
(At5g59460) OS=Arabidopsis thaliana GN=At5g59460 PE=2
SV=1
Length = 172

Score = 62.0 bits (149), Expect = 2e-08
Identities = 37/74 (50%), Positives = 50/74 (67%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
+FMQR+ + E KKA+E+ E + P++ R K+C VI + DP+PGALLGRMSF
Sbjct: 14 KFMQRSSLKVE-KKKADEE-----EPNGSFPSL-RTVAKKCVVITDWDPQPGALLGRMSF 66

Query: 153 QNCNTSIDKLLEEA 112
Q+ N SI+KL EEA
Sbjct: 67 QSFNPSIEKLHEEA 80


>tr|Q8LD59|Q8LD59_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 172

Score = 61.2 bits (147), Expect = 3e-08
Identities = 37/74 (50%), Positives = 50/74 (67%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
+FMQR+ + E KKA+E+ E + P++ A K+C VI + DP+PGALLGRMSF
Sbjct: 14 KFMQRSSLKVE-KKKADEE-----EPNGSFPSLGTVA-KKCVVITDWDPQPGALLGRMSF 66

Query: 153 QNCNTSIDKLLEEA 112
Q+ N SI+KL EEA
Sbjct: 67 QSFNPSIEKLHEEA 80


>tr|Q5ZBL4|Q5ZBL4_ORYSJ cDNA clone:006-309-E03, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0024G09.35 PE=2 SV=1
Length = 200

Score = 61.2 bits (147), Expect = 3e-08
Identities = 35/80 (43%), Positives = 47/80 (58%), Gaps = 6/80 (7%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAG------KRCTVILEGDPKPGAL 172
+FMQRA ++V +K + +A A VV + G ++C VI+EG+P PGA
Sbjct: 15 KFMQRAAVAQKVEEKPKVEAAAAAAEEEVVTVPSGGVGSSVKVARKCVVIMEGNPHPGAA 74

Query: 171 LGRMSFQNCNTSIDKLLEEA 112
GRMSF N N SIDKL +EA
Sbjct: 75 KGRMSFLNFNPSIDKLTQEA 94


>tr|B6LWH1|B6LWH1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_214287 PE=4 SV=1
Length = 156

Score = 44.7 bits (104), Expect = 0.003
Identities = 28/75 (37%), Positives = 38/75 (50%)
Frame = -3

Query: 333 QFMQRAKQREEVAKKAEEDATVADEGHWVVPAIARAAGKRCTVILEGDPKPGALLGRMSF 154
+FMQR +Q ++ K EE+ V DE HWV+ I VI P G GR SF
Sbjct: 18 KFMQRKQQSDDREKLEEEEQRVIDEEHWVLD-IPELKKLEYEVIDSFVPCEGLKYGRFSF 76

Query: 153 QNCNTSIDKLLEEAE 109
Q N +I+K+ + E
Sbjct: 77 QGFNPAIEKIAKSFE 91