BP921421
Clone id YMU001_000149_F11
Library
Length 583
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000149_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTGCAGGTAAGCAGCATATCATGCACTAGCACACATTTAAGCCTTGAACTTCAAAGTTC
ACAATAGTATCACAAAAATAGCTTCGACCCATTCGTTGGAATAAAATGAGCATCATCTTA
CCGTAGCCTTATATGATCCAAGGGAAGGCAATCAACCAATGGGGTTCCTATTGTCATCTA
TGTCTAATTGCAGTGTCCTCCCAGGCAATGCATCCGTTGGTCCAGAGGCATATAGCCCAG
GTAAATATGCTTTATATGCAGGCATATAGCGCGAAACAAAATCTTTTACCTCCTCGTCAG
TCATGCCTGGCCTTCCTGTCATTCTCATCCCAATCTCAGCCTGCAGACGCCATTTGTAGA
TTGCTTCTAAATTGCTCACTTTGATAACAATCCAGGAATCTACATACTTGTCCCAGGCAT
CATGATAAGCTGCAAGGTTCCGATTCACTTTTTCAAGCTGTGGGTCTATAGCTTGATAAG
CTGATGCAGCAACAGGTACAAAACCAAGCATCCATCCTTCAAACAGCAAAATCTTCAGTG
GCCCTTCAATCTCTGGCCACAACGAAGGGTCTGCTCTATCAGA
■■Homology search results ■■ -
sp_hit_id Q944I4
Definition sp|Q944I4|GLYK_ARATH D-glycerate 3-kinase, chloroplastic OS=Arabidopsis thaliana
Align length 141
Score (bit) 210.0
E-value 5.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921421|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_F11.
(583 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q944I4|GLYK_ARATH D-glycerate 3-kinase, chloroplastic OS=Arab... 210 5e-54
sp|Q9UUH3|MUG58_SCHPO Uncharacterized kinase mug58 OS=Schizosacc... 85 2e-16
sp|P42938|YG4F_YEAST Uncharacterized kinase YGR205W OS=Saccharom... 75 3e-13
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=M... 32 1.8
sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=H... 32 1.8
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE... 32 3.0
sp|Q7TT36|GP125_MOUSE Probable G-protein coupled receptor 125 OS... 31 3.9
sp|Q8IWK6|GP125_HUMAN Probable G-protein coupled receptor 125 OS... 31 3.9
sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae ... 30 6.7
sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1... 30 8.8
sp|Q0C9R3|CG121_ASPTN Protein cgi121 OS=Aspergillus terreus (str... 30 8.8

>sp|Q944I4|GLYK_ARATH D-glycerate 3-kinase, chloroplastic
OS=Arabidopsis thaliana GN=GLYK PE=1 SV=2
Length = 456

Score = 210 bits (534), Expect = 5e-54
Identities = 92/141 (65%), Positives = 114/141 (80%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRAD S WPE+EGPL ++LFEGWMLGF P+ A +A+DPQLE VN+NL AY+DAWDKY+
Sbjct: 313 DRADSSTWPEVEGPLSVILFEGWMLGFKPLPADVVKAVDPQLEVVNKNLEAYYDAWDKYI 372

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
D+W+VIK+ + +Y+WRLQAEI MR G+ GM+DEEV DFVSRY+PAYKAYLP LYA G
Sbjct: 373 DAWVVIKIQDPSYVYRWRLQAEIAMRQDGQAGMSDEEVNDFVSRYLPAYKAYLPTLYAEG 432

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P+ + P R L +DID+ RNPI
Sbjct: 433 PSGSDPDRVLAIDIDEERNPI 453


>sp|Q9UUH3|MUG58_SCHPO Uncharacterized kinase mug58
OS=Schizosaccharomyces pombe GN=mug58 PE=1 SV=1
Length = 277

Score = 85.1 bits (209), Expect = 2e-16
Identities = 53/151 (35%), Positives = 80/151 (52%), Gaps = 10/151 (6%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKI-LLFEGWMLGFVPV---------AASAYQAIDPQLEKVNRNLA 431
DR D S W + ++FEGWM+GF P+ ++ +Q I+ L VNR LA
Sbjct: 128 DRGDESQWKKANPKTTTYVIFEGWMVGFEPLDSCMLSVRARSTRWQNIEGSLLWVNRKLA 187

Query: 430 AYHDAWDKYVDSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYK 251
Y + K +DS + ++ + +Y+WRLQ E ++ GM+DEEV +FV+ YMP Y
Sbjct: 188 DYQPIFQK-IDSLVELEAQEINYVYRWRLQQEHALKARIHKGMSDEEVIEFVNHYMPQYV 246

Query: 250 AYLPGLYASGPTDALPGRTLQLDIDDNRNPI 158
YL L S P L++ +D+NR P+
Sbjct: 247 FYLGTL--SNKVHLNP-HCLEIILDENRYPV 274


>sp|P42938|YG4F_YEAST Uncharacterized kinase YGR205W
OS=Saccharomyces cerevisiae GN=YGR205W PE=1 SV=1
Length = 290

Score = 74.7 bits (182), Expect = 3e-13
Identities = 50/135 (37%), Positives = 65/135 (48%), Gaps = 5/135 (3%)
Frame = -1

Query: 553 EIEGPLKILLFEGWMLGFVPVAASAYQ--AIDPQLEKVNRNLAAYHDA-W--DKYVDSWI 389
+I+ P+ I + EGW LGF P+ + + VN L Y D W + I
Sbjct: 148 KIKLPVDIFILEGWFLGFNPILQGIENNDLLTGDMVDVNAKLFFYSDLLWRNPEIKSLGI 207

Query: 388 VIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASGPTDA 209
V N+ +Y WRLQ E + GMTDE+V FV RYMP+YK YL S +
Sbjct: 208 VFTTDNINNVYGWRLQQEHELISKVGKGMTDEQVHAFVDRYMPSYKLYLNDFVRSESLGS 267

Query: 208 LPGRTLQLDIDDNRN 164
+ TL L ID NRN
Sbjct: 268 I--ATLTLGIDSNRN 280


>sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus
musculus GN=Dip2b PE=1 SV=1
Length = 1574

Score = 32.3 bits (72), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 148 AINQWGSYCHLCLIAVSSQAMHPLVQRHIAQVNMLYMQAYSAKQNLLPPRQSCLAFLSFS 327
+I+Q G YC L L+ ++ PL HI+Q L+++ N+L +C+ L
Sbjct: 885 SIHQVGVYC-LALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKP 943

Query: 328 SQSQP 342
Q QP
Sbjct: 944 RQKQP 948


>sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo
sapiens GN=DIP2B PE=1 SV=3
Length = 1576

Score = 32.3 bits (72), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 148 AINQWGSYCHLCLIAVSSQAMHPLVQRHIAQVNMLYMQAYSAKQNLLPPRQSCLAFLSFS 327
+I+Q G YC L L+ ++ PL HI+Q L+++ N+L +C+ L
Sbjct: 887 SIHQVGVYC-LALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKP 945

Query: 328 SQSQP 342
Q QP
Sbjct: 946 RQKQP 950


>sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1
SV=2
Length = 3230

Score = 31.6 bits (70), Expect = 3.0
Identities = 19/47 (40%), Positives = 24/47 (51%)
Frame = +3

Query: 201 PGNASVGPEAYSPGKYALYAGI*RETKSFTSSSVMPGLPVILIPISA 341
PG S+ P SP AL G+ T SSS PG P++L P S+
Sbjct: 1488 PGPPSLAPSGASPSASALTLGL--ATAPSLSSSQTPGHPLLLAPTSS 1532


>sp|Q7TT36|GP125_MOUSE Probable G-protein coupled receptor 125
OS=Mus musculus GN=Gpr125 PE=2 SV=2
Length = 1310

Score = 31.2 bits (69), Expect = 3.9
Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
Frame = +1

Query: 232 IAQVNMLYMQAYSAKQNLLPPRQSCLAFLSFSSQSQPADAICRLLLNCSL**QSRNLHTC 411
+ N+L+M + ++N+ C+ S Q+QP + + LL C + + +
Sbjct: 179 LCDCNILWMHRWVKERNITVRDTRCV--YPKSLQAQPVTGVKQELLTCDPPLELPSFYMT 236

Query: 412 PRHHDKLQGSDSL-FQAVGL*LDKLMQQQVQNQASILQTAKS 534
P H + DSL FQ + +D+ MQ I++T +S
Sbjct: 237 PSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDES 278


>sp|Q8IWK6|GP125_HUMAN Probable G-protein coupled receptor 125
OS=Homo sapiens GN=GPR125 PE=1 SV=2
Length = 1321

Score = 31.2 bits (69), Expect = 3.9
Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
Frame = +1

Query: 232 IAQVNMLYMQAYSAKQNLLPPRQSCLAFLSFSSQSQPADAICRLLLNCSL**QSRNLHTC 411
+ N+L+M + ++N+ C+ S Q+QP + + LL C + + +
Sbjct: 190 LCDCNILWMHRWVKEKNITVRDTRCV--YPKSLQAQPVTGVKQELLTCDPPLELPSFYMT 247

Query: 412 PRHHDKLQGSDSL-FQAVGL*LDKLMQQQVQNQASILQTAKS 534
P H + DSL FQ + +D+ MQ I++T +S
Sbjct: 248 PSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDES 289


>sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae
GN=ROX1 PE=1 SV=1
Length = 368

Score = 30.4 bits (67), Expect = 6.7
Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 4/67 (5%)
Frame = +3

Query: 63 NSITKIASTHSLE*NEHHLTVALYDPREGNQP-MGFLLSSMSNCSVLP---GNASVGPEA 230
NSI ++ H H+L VA PR + P + F+ S ++N S P S
Sbjct: 199 NSIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTTTTTSTTTAT 258

Query: 231 YSPGKYA 251
SPGK++
Sbjct: 259 SSPGKFS 265


>sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1
homolog OS=Drosophila melanogaster GN=CG9004 PE=2 SV=1
Length = 854

Score = 30.0 bits (66), Expect = 8.8
Identities = 14/40 (35%), Positives = 21/40 (52%)
Frame = +1

Query: 256 MQAYSAKQNLLPPRQSCLAFLSFSSQSQPADAICRLLLNC 375
++A +A Q +PP Q L S S + A+ + RLL C
Sbjct: 316 LEASAAGQKYIPPHQRALMAASAGSSEKQAEILARLLKQC 355


tr_hit_id A8MQE0
Definition tr|A8MQE0|A8MQE0_ARATH Uncharacterized protein At1g80380.3 OS=Arabidopsis thaliana
Align length 141
Score (bit) 210.0
E-value 5.0e-53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921421|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_F11.
(583 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8MQE0|A8MQE0_ARATH Uncharacterized protein At1g80380.3 OS=Ar... 210 5e-53
tr|B8LL83|B8LL83_PICSI Putative uncharacterized protein OS=Picea... 203 7e-51
tr|B8A228|B8A228_MAIZE Putative uncharacterized protein OS=Zea m... 202 1e-50
tr|B4FYT5|B4FYT5_MAIZE Protein Kinase C630.09c OS=Zea mays PE=2 ... 202 1e-50
tr|Q5QLG3|Q5QLG3_ORYSJ cDNA clone:001-031-D08, full insert seque... 200 6e-50
tr|B8A7L7|B8A7L7_ORYSI Putative uncharacterized protein OS=Oryza... 200 6e-50
tr|A5BTK2|A5BTK2_VITVI Putative uncharacterized protein OS=Vitis... 197 4e-49
tr|A7P7I0|A7P7I0_VITVI Chromosome chr9 scaffold_7, whole genome ... 196 6e-49
tr|A9RDI1|A9RDI1_PHYPA Predicted protein (Fragment) OS=Physcomit... 192 2e-47
tr|A2ZWL2|A2ZWL2_ORYSJ Putative uncharacterized protein OS=Oryza... 154 5e-36
tr|A8IXZ1|A8IXZ1_CHLRE Glycerate kinase OS=Chlamydomonas reinhar... 116 1e-24
tr|A4RYR4|A4RYR4_OSTLU Predicted protein OS=Ostreococcus lucimar... 108 2e-22
tr|Q017E8|Q017E8_OSTTA Predicted kinase (ISS) OS=Ostreococcus ta... 108 3e-22
tr|B2ASK6|B2ASK6_PODAN Predicted CDS Pa_1_23800 OS=Podospora ans... 90 1e-16
tr|A3GGZ1|A3GGZ1_PICST Predicted protein OS=Pichia stipitis GN=P... 87 9e-16
tr|A9NLS6|A9NLS6_PICSI Putative uncharacterized protein OS=Picea... 83 1e-14
tr|Q6CI07|Q6CI07_YARLI YALI0A02717p OS=Yarrowia lipolytica GN=YA... 81 4e-14
tr|Q5KC52|Q5KC52_CRYNE Putative uncharacterized protein OS=Crypt... 81 4e-14
tr|Q4PDI9|Q4PDI9_USTMA Putative uncharacterized protein OS=Ustil... 81 4e-14
tr|Q6BIX1|Q6BIX1_DEBHA DEHA2G06952p OS=Debaryomyces hansenii GN=... 81 5e-14
tr|A5E6S0|A5E6S0_LODEL Putative uncharacterized protein OS=Lodde... 81 5e-14
tr|B2W0C2|B2W0C2_PYRTR Putative uncharacterized protein OS=Pyren... 80 6e-14
tr|B6K336|B6K336_SCHJP D-glycerate 3-kinase OS=Schizosaccharomyc... 80 8e-14
tr|A4QVY9|A4QVY9_MAGGR Putative uncharacterized protein OS=Magna... 79 2e-13
tr|A5DHV5|A5DHV5_PICGU Putative uncharacterized protein OS=Pichi... 78 4e-13
tr|Q0UTR4|Q0UTR4_PHANO Putative uncharacterized protein OS=Phaeo... 76 1e-12
tr|B5VJE7|B5VJE7_YEAS6 YGR205Wp-like protein OS=Saccharomyces ce... 75 4e-12
tr|B3LI31|B3LI31_YEAS1 Kinase OS=Saccharomyces cerevisiae (strai... 75 4e-12
tr|A6ZUL6|A6ZUL6_YEAS7 Conserved protein OS=Saccharomyces cerevi... 75 4e-12
tr|Q2H315|Q2H315_CHAGB Putative uncharacterized protein OS=Chaet... 72 2e-11

>tr|A8MQE0|A8MQE0_ARATH Uncharacterized protein At1g80380.3
OS=Arabidopsis thaliana GN=At1g80380 PE=4 SV=1
Length = 364

Score = 210 bits (534), Expect = 5e-53
Identities = 92/141 (65%), Positives = 114/141 (80%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRAD S WPE+EGPL ++LFEGWMLGF P+ A +A+DPQLE VN+NL AY+DAWDKY+
Sbjct: 221 DRADSSTWPEVEGPLSVILFEGWMLGFKPLPADVVKAVDPQLEVVNKNLEAYYDAWDKYI 280

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
D+W+VIK+ + +Y+WRLQAEI MR G+ GM+DEEV DFVSRY+PAYKAYLP LYA G
Sbjct: 281 DAWVVIKIQDPSYVYRWRLQAEIAMRQDGQAGMSDEEVNDFVSRYLPAYKAYLPTLYAEG 340

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P+ + P R L +DID+ RNPI
Sbjct: 341 PSGSDPDRVLAIDIDEERNPI 361


>tr|B8LL83|B8LL83_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 423

Score = 203 bits (516), Expect = 7e-51
Identities = 88/142 (61%), Positives = 114/142 (80%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DR DP WPEIEGPL ++L EGWMLGF P+++ +A+DPQLE VNRNL AY+DAW+K++
Sbjct: 282 DRGDPFTWPEIEGPLDVILLEGWMLGFKPLSSEVVKAVDPQLEAVNRNLEAYYDAWEKFI 341

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SWI+IKV + +Y+WRLQAEI MR G+PGM+DE+V DFVSRYMPAYKAYLP LY+ G
Sbjct: 342 GSWIIIKVDDTHWVYEWRLQAEIAMRKEGKPGMSDEQVADFVSRYMPAYKAYLPVLYSDG 401

Query: 220 PTDALPGRTLQLDIDDNRNPIG 155
P + P TL +++D++RNP+G
Sbjct: 402 PRGSNPEHTLIVEVDEHRNPLG 423


>tr|B8A228|B8A228_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 270

Score = 202 bits (513), Expect = 1e-50
Identities = 88/141 (62%), Positives = 111/141 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS+WPE+EGPL+++LFEGWMLGF P+ + +DPQLE VN+NL AY DAWD+++
Sbjct: 120 DRADPSVWPEVEGPLEVVLFEGWMLGFKPLPNEVVKEVDPQLEVVNKNLEAYSDAWDRFI 179

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SWIVIK+ ++Y+WRLQAE+ MR G+PGM+DEEV DFVSRY+PAY AYLP LY G
Sbjct: 180 QSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEG 239

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P + P L +DID+NRNPI
Sbjct: 240 PNGSNPDHLLVIDIDENRNPI 260


>tr|B4FYT5|B4FYT5_MAIZE Protein Kinase C630.09c OS=Zea mays PE=2
SV=1
Length = 429

Score = 202 bits (513), Expect = 1e-50
Identities = 88/141 (62%), Positives = 111/141 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS+WPE+EGPL+++LFEGWMLGF P+ + +DPQLE VN+NL AY DAWD+++
Sbjct: 279 DRADPSVWPEVEGPLEVVLFEGWMLGFKPLPNEVVKEVDPQLEVVNKNLEAYSDAWDRFI 338

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SWIVIK+ ++Y+WRLQAE+ MR G+PGM+DEEV DFVSRY+PAY AYLP LY G
Sbjct: 339 QSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEG 398

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P + P L +DID+NRNPI
Sbjct: 399 PNGSNPDHLLVIDIDENRNPI 419


>tr|Q5QLG3|Q5QLG3_ORYSJ cDNA clone:001-031-D08, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0019E03.36 PE=2 SV=1
Length = 418

Score = 200 bits (508), Expect = 6e-50
Identities = 87/141 (61%), Positives = 110/141 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS WPE+EGPL+++LFEGWMLGF P+ +A+DPQLE VN+NL AY+DAWD+++
Sbjct: 275 DRADPSTWPEVEGPLEVVLFEGWMLGFKPLPNEVVKAVDPQLEVVNKNLEAYYDAWDRFI 334

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SW+VIK+ +Y+WRLQAEI MR G+PGM+DEEV DFVSRY+PAY AYLP LY G
Sbjct: 335 GSWMVIKIKEPSCVYQWRLQAEIAMRADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEG 394

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P + P L +DID+ RNP+
Sbjct: 395 PNGSNPDHLLVVDIDEKRNPM 415


>tr|B8A7L7|B8A7L7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03288 PE=4 SV=1
Length = 418

Score = 200 bits (508), Expect = 6e-50
Identities = 87/141 (61%), Positives = 110/141 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS WPE+EGPL+++LFEGWMLGF P+ +A+DPQLE VN+NL AY+DAWD+++
Sbjct: 275 DRADPSTWPEVEGPLEVVLFEGWMLGFKPLPNEVVKAVDPQLEVVNKNLEAYYDAWDRFI 334

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SW+VIK+ +Y+WRLQAEI MR G+PGM+DEEV DFVSRY+PAY AYLP LY G
Sbjct: 335 GSWMVIKIKEPSCVYQWRLQAEIAMRADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEG 394

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P + P L +DID+ RNP+
Sbjct: 395 PNGSNPDHLLVVDIDEKRNPM 415


>tr|A5BTK2|A5BTK2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_010213 PE=4 SV=1
Length = 390

Score = 197 bits (501), Expect = 4e-49
Identities = 87/140 (62%), Positives = 110/140 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS WPE+EGPL +LFEGWMLGF P+ A +++DPQLE VN+NL AY+DAWDK++
Sbjct: 250 DRADPSTWPEVEGPLTAVLFEGWMLGFKPLPAEFVKSVDPQLETVNKNLEAYYDAWDKFI 309

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
WIVIK+ + +Y+WRLQAEI MR G+PGM+DEEV+DFVSRY+PAY AYLP LY+ G
Sbjct: 310 KVWIVIKIKDPSCVYEWRLQAEIAMRAEGKPGMSDEEVQDFVSRYLPAYNAYLPTLYSEG 369

Query: 220 PTDALPGRTLQLDIDDNRNP 161
P + R L ++ID+ RNP
Sbjct: 370 PNGSDXKRLLVIEIDEGRNP 389


>tr|A7P7I0|A7P7I0_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034473001
PE=4 SV=1
Length = 373

Score = 196 bits (499), Expect = 6e-49
Identities = 87/140 (62%), Positives = 110/140 (78%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS WPE+EGPL +LFEGWMLGF P+ A +++DPQLE VN+NL AY+DAWDK++
Sbjct: 233 DRADPSTWPEVEGPLTAVLFEGWMLGFKPLPAEFVKSVDPQLETVNKNLEAYYDAWDKFI 292

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
WIVIK+ + +Y+WRLQAEI MR G+PGM+DEEV+DFVSRY+PAY AYLP LY+ G
Sbjct: 293 KVWIVIKIKDPSCVYEWRLQAEIAMRAEGKPGMSDEEVQDFVSRYLPAYNAYLPTLYSEG 352

Query: 220 PTDALPGRTLQLDIDDNRNP 161
P + R L ++ID+ RNP
Sbjct: 353 PNGSDLKRLLVIEIDEGRNP 372


>tr|A9RDI1|A9RDI1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_111900 PE=4 SV=1
Length = 328

Score = 192 bits (487), Expect = 2e-47
Identities = 89/143 (62%), Positives = 110/143 (76%), Gaps = 1/143 (0%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKIL-LFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKY 404
DRADPS W +IEGP+K++ LFEGWMLGF P + ++DPQL +N+NL AY+DAW KY
Sbjct: 186 DRADPSKWEKIEGPVKVVVLFEGWMLGFEPQNEAEVTSVDPQLAPINKNLEAYYDAWHKY 245

Query: 403 VDSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYAS 224
+DSWIVI+V + +++WRLQAEI MRM G+PGMTDE+V DFVSRY+PAYKAYLP LY
Sbjct: 246 IDSWIVIQVDDPTWVFRWRLQAEIAMRMDGKPGMTDEQVADFVSRYVPAYKAYLPALYEH 305

Query: 223 GPTDALPGRTLQLDIDDNRNPIG 155
GP + L L ID+NRNPIG
Sbjct: 306 GPKGSEGEHLLMLHIDENRNPIG 328


>tr|A2ZWL2|A2ZWL2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_002934 PE=4 SV=1
Length = 393

Score = 154 bits (388), Expect = 5e-36
Identities = 73/141 (51%), Positives = 91/141 (64%)
Frame = -1

Query: 580 DRADPSLWPEIEGPLKILLFEGWMLGFVPVAASAYQAIDPQLEKVNRNLAAYHDAWDKYV 401
DRADPS WPE+EGPL +LE VN+NL AY+DAWD+++
Sbjct: 275 DRADPSTWPEVEGPL-------------------------ELEVVNKNLEAYYDAWDRFI 309

Query: 400 DSWIVIKVSNLEAIYKWRLQAEIGMRMTGRPGMTDEEVKDFVSRYMPAYKAYLPGLYASG 221
SW+VIK+ +Y+WRLQAEI MR G+PGM+DEEV DFVSRY+PAY AYLP LY G
Sbjct: 310 GSWMVIKIKEPSCVYQWRLQAEIAMRADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEG 369

Query: 220 PTDALPGRTLQLDIDDNRNPI 158
P + P L +DID+ RNP+
Sbjct: 370 PNGSNPDHLLVVDIDEKRNPM 390