BP921428
Clone id YMU001_000149_G08
Library
Length 442
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000149_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTATGTAACTGCTGTGGGTGGCTGTTTGGTCCCATTTGGGAGAAAAACACATCTTATTT
GGTCTCTATGTAGTGTAGAATGGAGTCTGGTAATGAAGTAGATGTGTAAGAATCCTGGCC
TGTAGAGGCACTATATGAGGAGTAATAGTTGCCCCCCAGTTGGTGTTTCTGCCAACCATA
AGGGCTCTTCTGCAGCGAGGAAACTAGCTGCCCTTATTGAGCCCACCCTTTCCAAGAAGA
TGAGCCGGGAAGTAGGCTACTAAAGGGCTGGTATTGCCCCTGTACCGGAAAGAGGTGCTT
CCAAAATGAGTGCTAAACAACTGCACCCAAAATACGTGTTTGTATGGTGCAATGGGAAAG
AGAGAGAACTATGAGTGGCTTCTTTGAAGTTTGAGGAGCTGGGGACTCACTTGCATCAAC
TATTTTACAATGGTCCTTGGGA
■■Homology search results ■■ -
sp_hit_id B0CCR3
Definition sp|B0CCR3|COBQ_ACAM1 Cobyric acid synthase OS=Acaryochloris marina (strain MBIC 11017)
Align length 40
Score (bit) 32.7
E-value 0.68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921428|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_G08.
(442 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B0CCR3|COBQ_ACAM1 Cobyric acid synthase OS=Acaryochloris mari... 33 0.68
sp|Q8NBF4|YG006_HUMAN Putative uncharacterized protein FLJ33307 ... 32 1.2
sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein ... 30 3.4
sp|P10388|GLT5_WHEAT Glutenin, high molecular weight subunit DX5... 30 5.9
sp|P08489|GLT4_WHEAT Glutenin, high molecular weight subunit PW2... 30 5.9
sp|Q8N7Z5|ANR31_HUMAN Ankyrin repeat domain-containing protein 3... 30 5.9
sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xe... 29 7.5
sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mu... 29 7.5
sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS... 29 7.5
sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS... 29 7.5
sp|P08488|GLT3_WHEAT Glutenin, high molecular weight subunit 12 ... 29 10.0
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN... 29 10.0

>sp|B0CCR3|COBQ_ACAM1 Cobyric acid synthase OS=Acaryochloris marina
(strain MBIC 11017) GN=cobQ PE=3 SV=1
Length = 497

Score = 32.7 bits (73), Expect = 0.68
Identities = 17/40 (42%), Positives = 22/40 (55%)
Frame = +3

Query: 321 LHPKYVFVWCNGKEREL*VASLKFEELGTHLHQLFYNGPW 440
L P+ V W + + L V S LGT+LH +F NGPW
Sbjct: 408 LQPEAVQAWFD--DPALGVVSCNHRILGTYLHGIFNNGPW 445


>sp|Q8NBF4|YG006_HUMAN Putative uncharacterized protein FLJ33307
OS=Homo sapiens PE=2 SV=1
Length = 154

Score = 32.0 bits (71), Expect = 1.2
Identities = 20/51 (39%), Positives = 30/51 (58%)
Frame = +3

Query: 147 SCPPVGVSANHKGSSAARKLAALIEPTLSKKMSREVGY*RAGIAPVPERGA 299
S P+ VSA+H+G + R L++PTLS+ S G ++ +P P RGA
Sbjct: 108 STAPMAVSASHRGGTGTR--TWLVDPTLSRDTSPLGG--QSWGSPQPSRGA 154


>sp|Q4P937|UTP10_USTMA U3 small nucleolar RNA-associated protein 10
OS=Ustilago maydis GN=UTP10 PE=3 SV=1
Length = 2251

Score = 30.4 bits (67), Expect = 3.4
Identities = 19/58 (32%), Positives = 26/58 (44%)
Frame = -2

Query: 426 KIVDASESPAPQTSKKPLIVLSLSHCTIQTRILGAVV*HSFWKHLFPVQGQYQPFSSL 253
KIV S S A QT + PL V+S +Q R+L H W+ + + SL
Sbjct: 1485 KIVKQSRSDAEQTLQLPLAVVSPHSAMVQVRVL-----HQVWEEVLRIWANRDETESL 1537


>sp|P10388|GLT5_WHEAT Glutenin, high molecular weight subunit DX5
OS=Triticum aestivum GN=GLU-1D-1D PE=3 SV=4
Length = 839

Score = 29.6 bits (65), Expect = 5.9
Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 8/65 (12%)
Frame = -2

Query: 294 LFPVQGQ--YQPFSSLLPGSSSWKG-WAQ*GQ-----LVSSLQKSPYGWQKHQLGGNYYS 139
L P QGQ Y P S P G W Q GQ +SLQ++ G Q Q YYS
Sbjct: 739 LQPGQGQQGYYPTSPQQPPQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYS 798

Query: 138 SYSAS 124
SY S
Sbjct: 799 SYHVS 803


>sp|P08489|GLT4_WHEAT Glutenin, high molecular weight subunit PW212
OS=Triticum aestivum PE=3 SV=1
Length = 838

Score = 29.6 bits (65), Expect = 5.9
Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 8/65 (12%)
Frame = -2

Query: 294 LFPVQGQ--YQPFSSLLPGSSSWKG-WAQ*GQ-----LVSSLQKSPYGWQKHQLGGNYYS 139
L P QGQ Y P S G G W Q GQ +SLQ++ G Q Q YYS
Sbjct: 738 LQPGQGQQGYYPTSPQQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYS 797

Query: 138 SYSAS 124
SY S
Sbjct: 798 SYHVS 802


>sp|Q8N7Z5|ANR31_HUMAN Ankyrin repeat domain-containing protein 31
OS=Homo sapiens GN=ANKRD31 PE=2 SV=2
Length = 1873

Score = 29.6 bits (65), Expect = 5.9
Identities = 19/62 (30%), Positives = 30/62 (48%)
Frame = -2

Query: 195 LQKSPYGWQKHQLGGNYYSSYSASTGQDSYTSTSLPDSILHYIETK*DVFFSQMGPNSHP 16
+ K+P W K LGGN Y +++ + + +Y L +L Y+ + PNS P
Sbjct: 1741 IYKNPVTWLKDLLGGNSYVTWNYAWSKVTY----LGKELLRYVSEDAPIL---PEPNSVP 1793

Query: 15 QQ 10
QQ
Sbjct: 1794 QQ 1795


>sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5
OS=Xenopus tropicalis GN=mcm5 PE=2 SV=1
Length = 735

Score = 29.3 bits (64), Expect = 7.5
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = +3

Query: 150 CPPVGVSANHKGSSAARKLAALIEPTLSKKMSREVG 257
C P+GV + KGSSAA A+++ +S+ E G
Sbjct: 398 CSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGG 433


>sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mus
musculus GN=Mcm5 PE=2 SV=1
Length = 733

Score = 29.3 bits (64), Expect = 7.5
Identities = 15/36 (41%), Positives = 20/36 (55%)
Frame = +3

Query: 150 CPPVGVSANHKGSSAARKLAALIEPTLSKKMSREVG 257
C P+GV + KGSSAA A++I S+ E G
Sbjct: 396 CSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGG 431


>sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B
OS=Xenopus laevis GN=mcm5-B PE=2 SV=1
Length = 735

Score = 29.3 bits (64), Expect = 7.5
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = +3

Query: 150 CPPVGVSANHKGSSAARKLAALIEPTLSKKMSREVG 257
C P+GV + KGSSAA A+++ +S+ E G
Sbjct: 398 CSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGG 433


>sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A
OS=Xenopus laevis GN=mcm5-A PE=1 SV=2
Length = 735

Score = 29.3 bits (64), Expect = 7.5
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = +3

Query: 150 CPPVGVSANHKGSSAARKLAALIEPTLSKKMSREVG 257
C P+GV + KGSSAA A+++ +S+ E G
Sbjct: 398 CSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGG 433


tr_hit_id A0ZL77
Definition tr|A0ZL77|A0ZL77_NODSP C-5 cytosine-specific DNA methylase OS=Nodularia spumigena CCY 9414
Align length 64
Score (bit) 36.2
E-value 0.83
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921428|Adiantum capillus-veneris mRNA, clone:
YMU001_000149_G08.
(442 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A0ZL77|A0ZL77_NODSP C-5 cytosine-specific DNA methylase OS=No... 36 0.83
tr|Q6DKB4|Q6DKB4_XENLA MGC84691 protein OS=Xenopus laevis GN=MGC... 33 7.0
tr|Q24W41|Q24W41_DESHY Putative uncharacterized protein OS=Desul... 33 7.0
tr|Q4JMK0|Q4JMK0_9BACT Predicted phytoene desaturase OS=uncultur... 33 9.2
tr|Q0Q5D2|Q0Q5D2_WHEAT X-type HMW glutenin OS=Triticum aestivum ... 33 9.2
tr|B8A1Z7|B8A1Z7_MAIZE Putative uncharacterized protein OS=Zea m... 33 9.2
tr|A9YSK4|A9YSK4_WHEAT High molecular weight glutenin subunit OS... 33 9.2

>tr|A0ZL77|A0ZL77_NODSP C-5 cytosine-specific DNA methylase
OS=Nodularia spumigena CCY 9414 GN=N9414_06404 PE=3 SV=1
Length = 424

Score = 36.2 bits (82), Expect = 0.83
Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
Frame = -1

Query: 208 ASFLAAEEPLWLAETPTGGQLLLLI*CLYRPGFLHIYFITRLHSTLH----RDQIRCVFL 41
+ FLA EP L GG+ L Y+PG L I RLH T H R++ ++L
Sbjct: 309 SQFLATNEPAPLLIERVGGRKL----AKYKPGHLPANTILRLHFTDHKGCNRNKFADIWL 364

Query: 40 PNGT 29
PNGT
Sbjct: 365 PNGT 368


>tr|Q6DKB4|Q6DKB4_XENLA MGC84691 protein OS=Xenopus laevis
GN=MGC84691 PE=2 SV=1
Length = 536

Score = 33.1 bits (74), Expect = 7.0
Identities = 23/77 (29%), Positives = 31/77 (40%), Gaps = 10/77 (12%)
Frame = -2

Query: 282 QGQYQPFSSLLPGSSSWKGWAQ*GQLVSSLQKSP----------YGWQKHQLGGNYYSSY 133
Q Y +S P SS+ ++ Q + Q+ YG Q+ GG SSY
Sbjct: 99 QSSYSSYSQQPPASSNTGSYSGSSQSSTYQQQQSGGYGQQPSGGYGSQQSSYGGQQQSSY 158

Query: 132 SASTGQDSYTSTSLPDS 82
+ GQ SY S P S
Sbjct: 159 GSQQGQGSYGSQQQPSS 175


>tr|Q24W41|Q24W41_DESHY Putative uncharacterized protein
OS=Desulfitobacterium hafniense (strain Y51) GN=DSY1962
PE=4 SV=1
Length = 1965

Score = 33.1 bits (74), Expect = 7.0
Identities = 13/30 (43%), Positives = 18/30 (60%)
Frame = -2

Query: 156 GGNYYSSYSASTGQDSYTSTSLPDSILHYI 67
GG YY S+ G +T+LPD+ LHY+
Sbjct: 428 GGTYYFDLSSEKGNIGTANTALPDTTLHYV 457


>tr|Q4JMK0|Q4JMK0_9BACT Predicted phytoene desaturase OS=uncultured
bacterium BAC17H8 GN=crtI PE=4 SV=1
Length = 517

Score = 32.7 bits (73), Expect = 9.2
Identities = 18/55 (32%), Positives = 30/55 (54%)
Frame = -2

Query: 168 KHQLGGNYYSSYSASTGQDSYTSTSLPDSILHYIETK*DVFFSQMGPNSHPQQLH 4
KH L +S + G + +T+TS+ +++HY+E + VFF G +QLH
Sbjct: 192 KHPLLRQAFSIHPLLVGGNPFTTTSIY-ALIHYLERRWGVFFCMGGTGRLVEQLH 245


>tr|Q0Q5D2|Q0Q5D2_WHEAT X-type HMW glutenin OS=Triticum aestivum
PE=4 SV=1
Length = 848

Score = 32.7 bits (73), Expect = 9.2
Identities = 27/65 (41%), Positives = 30/65 (46%), Gaps = 8/65 (12%)
Frame = -2

Query: 294 LFPVQGQ--YQPFSSLLPGSSSWKG-WAQ*GQ-----LVSSLQKSPYGWQKHQLGGNYYS 139
L P QGQ Y P S PG G W Q GQ +SLQ++ G Q Q YYS
Sbjct: 748 LQPGQGQQGYYPTSPQQPGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYS 807

Query: 138 SYSAS 124
SY S
Sbjct: 808 SYHVS 812


>tr|B8A1Z7|B8A1Z7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 349

Score = 32.7 bits (73), Expect = 9.2
Identities = 18/65 (27%), Positives = 32/65 (49%)
Frame = -2

Query: 423 IVDASESPAPQTSKKPLIVLSLSHCTIQTRILGAVV*HSFWKHLFPVQGQYQPFSSLLPG 244
++DAS P P+ + L+ L+L C+++ R A+ + W+ L ++ P
Sbjct: 285 VLDASAGPWPEVQAEKLMKLALRCCSLERRRRPAITSDAEWRSLDILRAMVN------PA 338

Query: 243 SSSWK 229
S SWK
Sbjct: 339 SKSWK 343


>tr|A9YSK4|A9YSK4_WHEAT High molecular weight glutenin subunit
OS=Triticum aestivum GN=Glu-D1-1 PE=4 SV=1
Length = 839

Score = 32.7 bits (73), Expect = 9.2
Identities = 27/65 (41%), Positives = 30/65 (46%), Gaps = 8/65 (12%)
Frame = -2

Query: 294 LFPVQGQ--YQPFSSLLPGSSSWKG-WAQ*GQ-----LVSSLQKSPYGWQKHQLGGNYYS 139
L P QGQ Y P S PG G W Q GQ +SLQ++ G Q Q YYS
Sbjct: 739 LQPGQGQQGYYPTSPQQPGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYS 798

Query: 138 SYSAS 124
SY S
Sbjct: 799 SYHVS 803