BP921452
Clone id YMU001_000150_B01
Library
Length 520
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000150_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTGGAATGCTTTTAAGCACCTGAGTTGCGAAATCTGGACCACCTTCCCCTTCATTCATT
AACAATCTCAGTGACTCTTCATCTGACAAACCACCTTTCTTGACCATAGAGTCTGTTTCC
GACATTGAAGCCACCGCATTCACTCTTAACGACAACCGCCTTGTGCCCATAACAGAGCAA
CCTTGGCATAAACAAGGGCCTACAGAACCGTATAGAAGTCGGACTAGCCCCAGTCTTATG
AAATCCAAGAAGAGAGGTCTGCTTCCACATATTGATGCACTGGAAATCTCCTCTACTATT
ACAAGACAAAGATGACCTTTCCATTACTGCCCAATTCCTCAATGCATTCACTTGGCTGCT
GCGTAAGACCTCAAAAGATCAAACCTCCACTCTTTAAGCGTGGCTGCTGCATGTGAGAAC
TAAATCCAAACAAGAAAAGCTGCACTAGCTGAAGAGAAGCTGCACCTTGAAGTCCTGTAT
AGTAGCCAACTACGAGAGGTACGTCTTTATCTCTCACCAT
■■Homology search results ■■ -
sp_hit_id Q18412
Definition sp|Q18412|SGO1_CAEEL Shugoshin OS=Caenorhabditis elegans
Align length 74
Score (bit) 35.0
E-value 0.21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921452|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_B01.
(520 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q18412|SGO1_CAEEL Shugoshin OS=Caenorhabditis elegans GN=sgo-... 35 0.21
sp|Q55GE7|Y2120_DICDI Uncharacterized protein DDB_G0268318 OS=Di... 30 5.2
sp|Q5ADP9|PTPA1_CANAL Serine/threonine-protein phosphatase 2A ac... 30 5.3
sp|Q96RS0|TGS1_HUMAN Trimethylguanosine synthase homolog OS=Homo... 30 6.9
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=... 30 6.9
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=... 30 6.9
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile ele... 30 6.9
sp|Q9Z2Y8|PROSC_MOUSE Proline synthetase co-transcribed bacteria... 30 6.9
sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic vir... 30 6.9
sp|Q9UT10|YLW5_SCHPO Uncharacterized GTP-binding protein P8A3.05... 30 9.0
sp|O42956|YGM8_SCHPO Uncharacterized protein C19G7.08c OS=Schizo... 30 9.0

>sp|Q18412|SGO1_CAEEL Shugoshin OS=Caenorhabditis elegans GN=sgo-1
PE=2 SV=2
Length = 307

Score = 35.0 bits (79), Expect = 0.21
Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 2/74 (2%)
Frame = +1

Query: 97 FLTIESVSDIEATAFTLNDNRLVPITEQPWHKQ-GPTEPY-RSRTSPSLMKSKKRGLLPH 270
F + + S I A T+ NR P+ P GP++P R +P K L P
Sbjct: 199 FQSFNADSSIVEEASTIPTNRRAPMLIAPSSTPAGPSKPTARKPPTPRFKKPSTPALAPQ 258

Query: 271 IDALEISSTITRQR 312
D E+SST+ RQR
Sbjct: 259 SDDTELSSTVRRQR 272


>sp|Q55GE7|Y2120_DICDI Uncharacterized protein DDB_G0268318
OS=Dictyostelium discoideum GN=DDB_G0268318 PE=4 SV=1
Length = 274

Score = 30.4 bits (67), Expect = 5.2
Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
Frame = -3

Query: 143 VNAVASMSETDSMVKKGGLSDEESLRLLMNE--GEGGPDFATQVL 15
VN S+S MVKK LSD ES++ N G+G D ++V+
Sbjct: 43 VNKNLSLSREIEMVKKNSLSDLESMKSFYNTNFGKGNSDLMSKVV 87


>sp|Q5ADP9|PTPA1_CANAL Serine/threonine-protein phosphatase 2A
activator 1 OS=Candida albicans GN=RRD1 PE=3 SV=1
Length = 424

Score = 30.4 bits (67), Expect = 5.3
Identities = 12/43 (27%), Positives = 19/43 (44%)
Frame = +1

Query: 58 INNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQPW 186
+N ++ DKPP T+ S + T + +P T PW
Sbjct: 361 VNEKEETELDKPPETTLNSTTTTTTTTKVSSSTSKIPFTPAPW 403


>sp|Q96RS0|TGS1_HUMAN Trimethylguanosine synthase homolog OS=Homo
sapiens GN=TGS1 PE=1 SV=2
Length = 853

Score = 30.0 bits (66), Expect = 6.9
Identities = 20/74 (27%), Positives = 37/74 (50%)
Frame = +1

Query: 34 SGPPSPSFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQPWHKQGPTEPY 213
S P SP ++N S +SDK ++ +S+I+ + + ++L T H+Q +E
Sbjct: 294 SFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQ-LSEVS 352

Query: 214 RSRTSPSLMKSKKR 255
R P+ +S+ R
Sbjct: 353 SKRECPASGQSEPR 366


>sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1
SV=1
Length = 1994

Score = 30.0 bits (66), Expect = 6.9
Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 6/82 (7%)
Frame = +1

Query: 46 SPSFINNLSDSSSDKPPFLTIESVSDIEAT---AFTLNDNRLVPITEQPWHKQGPTEPYR 216
SPS N++S +S+ P F S+ +E A+ + + L P++ P P+EP R
Sbjct: 1787 SPSS-NSISSTSNLTPTFRPSSSIQQMEIPLKPAYDRSCDELSPVS--PTQGGYPSEPTR 1843

Query: 217 SRTSP---SLMKSKKRGLLPHI 273
SRT+P + K+ + PH+
Sbjct: 1844 SRTTPFMGIIDKTARTQQYPHL 1865


>sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1
SV=3
Length = 1990

Score = 30.0 bits (66), Expect = 6.9
Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 6/82 (7%)
Frame = +1

Query: 46 SPSFINNLSDSSSDKPPFLTIESVSDIEAT---AFTLNDNRLVPITEQPWHKQGPTEPYR 216
SPS N++S +S+ P F S+ +E A+ + + L P++ P P+EP R
Sbjct: 1783 SPSS-NSISSTSNLTPTFRPSSSIQQMEIPLKPAYERSCDELSPVS--PTQGGYPSEPTR 1839

Query: 217 SRTSP---SLMKSKKRGLLPHI 273
SRT+P + K+ + PH+
Sbjct: 1840 SRTTPFMGIIDKTARTQQYPHL 1861


>sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile
element jockey OS=Drosophila melanogaster GN=pol PE=1
SV=1
Length = 916

Score = 30.0 bits (66), Expect = 6.9
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = -2

Query: 267 WKQTSLLGFHKTGASPTSIRFCRP 196
WK S++ HKTG +PT + RP
Sbjct: 494 WKSASIIMIHKTGKTPTDVDSYRP 517


>sp|Q9Z2Y8|PROSC_MOUSE Proline synthetase co-transcribed bacterial
homolog protein OS=Mus musculus GN=Prosc PE=1 SV=1
Length = 274

Score = 30.0 bits (66), Expect = 6.9
Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = +1

Query: 55 FINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQPWHKQGPTEPYRSRTSPS 234
FI +L + +K + + ++S +E T++ +L W K+GPTEP + +
Sbjct: 93 FIGHLQKQNVNK--LMAVPNLSMLE----TVDSVKLADKVNSSWQKKGPTEPLKVMVQIN 146

Query: 235 LM-KSKKRGLLP 267
+ K GLLP
Sbjct: 147 TSGEDSKHGLLP 158


>sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic virus
PE=3 SV=2
Length = 3056

Score = 30.0 bits (66), Expect = 6.9
Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
Frame = +2

Query: 251 REVCFHILM--HWKSPLLLQDKDDLSITAQFLNAFTWLLRKTSKDQTSTL*AWLLHVRTK 424
+E+ H+ + HW P+L+Q D I A L W+L + K +TS A++ + +
Sbjct: 1780 QEISKHLQLKGHWNKPVLIQ---DFLIAAGVLGGGCWMLYQYFKQETSK--AFVFQGKNR 1834

Query: 425 SKQEKL 442
++KL
Sbjct: 1835 RTKQKL 1840


>sp|Q9UT10|YLW5_SCHPO Uncharacterized GTP-binding protein P8A3.05
OS=Schizosaccharomyces pombe GN=SPAP8A3.05 PE=2 SV=1
Length = 695

Score = 29.6 bits (65), Expect = 9.0
Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 6/70 (8%)
Frame = +1

Query: 1 LGMLLST*VAKSGPPSP------SFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRL 162
L LL++ AK PPS S + S SSSD P F S +D + T+ND
Sbjct: 4 LSQLLNSKKAKQKPPSEHPIGLSSILKQDSSSSSDSPNFFPSSSTNDHQERD-TINDTNF 62

Query: 163 VPITEQPWHK 192
V +Q K
Sbjct: 63 VVPEKQKTSK 72


tr_hit_id Q3A4V5
Definition tr|Q3A4V5|Q3A4V5_PELCD Cation transport ATPase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
Align length 96
Score (bit) 36.2
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921452|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_B01.
(520 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q3A4V5|Q3A4V5_PELCD Cation transport ATPase OS=Pelobacter car... 36 1.00
tr|B7QKM3|B7QKM3_IXOSC Putative uncharacterized protein (Fragmen... 36 1.3
tr|B4XWB7|B4XWB7_COLGL Glutamate dehydrogenase (Fragment) OS=Col... 34 5.0
tr|B2JC21|B2JC21_NOSP7 Putative uncharacterized protein OS=Nosto... 33 8.5
tr|B4N665|B4N665_DROWI GK18008 OS=Drosophila willistoni GN=GK180... 33 8.5
tr|Q1E858|Q1E858_COCIM Putative uncharacterized protein OS=Cocci... 33 8.5
tr|Q311I2|Q311I2_DESDG Putative GTPases (G3E family)-like OS=Des... 33 8.5

>tr|Q3A4V5|Q3A4V5_PELCD Cation transport ATPase OS=Pelobacter
carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_1354
PE=3 SV=1
Length = 906

Score = 36.2 bits (82), Expect = 1.00
Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
Frame = +1

Query: 148 NDNRLVPITEQPWHKQG-PTEP--YRSRTSPSLMKSKKRGLLPHIDALEISSTITRQR*P 318
ND+RLVP EQ WH +G PTE + LM+ ++ LLP D L S +
Sbjct: 392 NDSRLVPKGEQ-WHIEGDPTEAALIAAAAKAGLMQDEQERLLPRWDVLPFESQ-HQYMAT 449

Query: 319 FHYCPIPQC--IHLAAA*DLKRSNLH-SLSVAAACE 417
H CP C I+L + + H S A CE
Sbjct: 450 LHTCPEDDCQVIYLKGSIESVLDRCHQSCETADGCE 485


>tr|B7QKM3|B7QKM3_IXOSC Putative uncharacterized protein (Fragment)
OS=Ixodes scapularis GN=IscW_ISCW013682 PE=4 SV=1
Length = 143

Score = 35.8 bits (81), Expect = 1.3
Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
Frame = +1

Query: 28 AKSGPPSPSFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLV-PITEQPWHKQGPT 204
++ GPP S I +D S+ + P LTIE++ IEA + T+ N L+ ++ P KQ
Sbjct: 67 SRRGPPLASLIRACTDLSNQRQPTLTIEAIG-IEALSVTITANELIYETSKSPRWKQANF 125

Query: 205 EPYRSR 222
+R +
Sbjct: 126 PVWRRK 131


>tr|B4XWB7|B4XWB7_COLGL Glutamate dehydrogenase (Fragment)
OS=Colletotrichum gloeosporioides PE=2 SV=1
Length = 430

Score = 33.9 bits (76), Expect = 5.0
Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 14/102 (13%)
Frame = -3

Query: 269 CGSRPLFLDFIRLGLVRLLYGSVGPCLCQGCSVMGTRRLSLRVNAVASMSETDSMVKKGG 90
CG RP +D I + + S P L +G ++ T+ LR+ + D+ KGG
Sbjct: 215 CGGRPESIDLISVNKIIKDGKSTIPYLVEGANLFITQDAKLRLEEAGCILYKDASANKGG 274

Query: 89 LS-------------DEESLRLLMNEGEG-GPDFATQVLKSI 6
++ DE L+ + ++ +G P F +KS+
Sbjct: 275 VTSSSLEVLASLAFDDENFLKHMCHDAKGQAPQFYQDYVKSV 316


>tr|B2JC21|B2JC21_NOSP7 Putative uncharacterized protein OS=Nostoc
punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_EF007 PE=4 SV=1
Length = 164

Score = 33.1 bits (74), Expect = 8.5
Identities = 27/78 (34%), Positives = 35/78 (44%)
Frame = +1

Query: 46 SPSFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQPWHKQGPTEPYRSRT 225
S S NNLS SSSDK ++ S S+ E+T + N LV E P E
Sbjct: 80 STSTDNNLSSSSSDKAVEESVNSDSEPESTDSSTTTNDLVSPVEP---DSSPIESSEPSG 136

Query: 226 SPSLMKSKKRGLLPHIDA 279
S S SK++ P+ A
Sbjct: 137 SSSSKTSKRKKTTPNTSA 154


>tr|B4N665|B4N665_DROWI GK18008 OS=Drosophila willistoni GN=GK18008
PE=4 SV=1
Length = 156

Score = 33.1 bits (74), Expect = 8.5
Identities = 28/88 (31%), Positives = 42/88 (47%)
Frame = +1

Query: 1 LGMLLST*VAKSGPPSPSFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQ 180
L +LS+ VAKS +N L+ S+ DK + T + D + D +P+ E
Sbjct: 2 LRQILSSAVAKSTRGLSFTVNRLA-SNLDKSEYTTPGEIIDYD-------DPTHLPVPEY 53

Query: 181 PWHKQGPTEPYRSRTSPSLMKSKKRGLL 264
P P EP +R L +S+KRG+L
Sbjct: 54 PLR---PDEPLETRKQRLLYQSRKRGML 78


>tr|Q1E858|Q1E858_COCIM Putative uncharacterized protein
OS=Coccidioides immitis GN=CIMG_01255 PE=4 SV=1
Length = 566

Score = 33.1 bits (74), Expect = 8.5
Identities = 18/63 (28%), Positives = 28/63 (44%)
Frame = +1

Query: 40 PPSPSFINNLSDSSSDKPPFLTIESVSDIEATAFTLNDNRLVPITEQPWHKQGPTEPYRS 219
PP P+ +N++ + SS KP +T S+ T L+ + P W P+ P
Sbjct: 427 PPKPNEMNSIFNLSSSKPQTITQSPPSNAATTTSMLSSVNIDPWGGNAWASTDPSPPTTQ 486

Query: 220 RTS 228
TS
Sbjct: 487 PTS 489


>tr|Q311I2|Q311I2_DESDG Putative GTPases (G3E family)-like
OS=Desulfovibrio desulfuricans (strain G20) GN=Dde_1617
PE=3 SV=1
Length = 625

Score = 33.1 bits (74), Expect = 8.5
Identities = 22/66 (33%), Positives = 32/66 (48%)
Frame = -3

Query: 257 PLFLDFIRLGLVRLLYGSVGPCLCQGCSVMGTRRLSLRVNAVASMSETDSMVKKGGLSDE 78
P F R G + +LYGSV G ++ RL +R +A ET +V+ GGL ++
Sbjct: 124 PDFAGLFRTGTLDVLYGSVPAAF--GLRLVAENRLRIRCDAGLYSEETGWVVEPGGLEED 181

Query: 77 ESLRLL 60
LL
Sbjct: 182 LPALLL 187