BP921453
Clone id YMU001_000150_B02
Library
Length 564
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000150_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TAGATATTACCTGCAGGTACTCCAGACAGGAGGCCTCTCTCGCACACAATATACACGCGC
ACTCGGACTCGATCATGTTGCTGCGTCGACACCACCAGATGCTCTTCACTCTTCTGGCGC
TGCTTTTCTGCTTCATCGCCTGCTGCCATGGCTACCGCCACAAGAGCTCGGACAGTAATG
AGACTGCTTATGAGATTCTCGAGAGCTATGGATTTCCGAGTGACCTTCTCCCGGAAACGG
TAATAGCCTACGATCTGGAAGATACTGGTGCCTTTGCGCTCGATCTCGATGGGTCATGCA
CTGTCAATATCCCTGATGCGTACCCCGTGAAGTACTCATCAGTAATTTCCGGCAACATTG
CGTCCGGCAGCCTCTCCAACCTCAGTGGGATCACCGTCAAAGTTCTCTTCATCTGGTGGA
ACATTGATTCCATTTCCCTCAGCGGCGACGACCTGGTCTTCCATGTCGATCCTGCCACCG
CCAGCTACCCCATCTTAAATTTCAGTGAGAACCCGATTTGTGACGGTAATTCTCGTCACG
CTAGTCTCGTCCAGGCTCTTTGAT
■■Homology search results ■■ -
sp_hit_id Q9M015
Definition sp|Q9M015|Y5161_ARATH Uncharacterized protein At5g01610 OS=Arabidopsis thaliana
Align length 91
Score (bit) 48.5
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921453|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_B02.
(564 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9M015|Y5161_ARATH Uncharacterized protein At5g01610 OS=Arabi... 49 2e-05
sp|Q5ZL34|CPSF6_CHICK Cleavage and polyadenylation specificity f... 34 0.43
sp|Q5UPN3|YL167_MIMIV Uncharacterized protein L167 OS=Acanthamoe... 34 0.57
sp|Q5NVH8|CPSF6_PONAB Cleavage and polyadenylation specificity f... 33 0.97
sp|Q6NVF9|CPSF6_MOUSE Cleavage and polyadenylation specificity f... 33 0.97
sp|Q16630|CPSF6_HUMAN Cleavage and polyadenylation specificity f... 33 0.97
sp|Q0P5D2|CPSF6_BOVIN Cleavage and polyadenylation specificity f... 33 0.97
sp|Q7NBY8|SYA_MYCGA Alanyl-tRNA synthetase OS=Mycoplasma gallise... 32 2.8
sp|B1M0N0|SYA_METRJ Alanyl-tRNA synthetase OS=Methylobacterium r... 31 3.7
sp|B0SZN4|SYA_CAUSK Alanyl-tRNA synthetase OS=Caulobacter sp. (s... 31 3.7
sp|Q9A5C1|SYA_CAUCR Alanyl-tRNA synthetase OS=Caulobacter cresce... 31 3.7
sp|A8AVD7|CODY_STRGC GTP-sensing transcriptional pleiotropic rep... 31 3.7
sp|Q05582|CAS2_STRCL Clavaminate synthase 2 OS=Streptomyces clav... 31 4.8
sp|Q1LSS9|SYI_BAUCH Isoleucyl-tRNA synthetase OS=Baumannia cicad... 30 6.3
sp|Q74ZC1|DBP9_ASHGO ATP-dependent RNA helicase DBP9 OS=Ashbya g... 30 6.3
sp|Q1J564|CODY_STRPF GTP-sensing transcriptional pleiotropic rep... 30 6.3
sp|A2RIH1|TRUA_LACLM tRNA pseudouridine synthase A OS=Lactococcu... 30 8.2
sp|Q8EPH5|SYFB_OCEIH Phenylalanyl-tRNA synthetase beta chain OS=... 30 8.2
sp|Q1R1E5|DXS_CHRSD 1-deoxy-D-xylulose-5-phosphate synthase OS=C... 30 8.2
sp|P62639|CHEB2_GEOSL Chemotaxis response regulator protein-glut... 30 8.2

>sp|Q9M015|Y5161_ARATH Uncharacterized protein At5g01610
OS=Arabidopsis thaliana GN=At5g01610 PE=1 SV=1
Length = 170

Score = 48.5 bits (114), Expect = 2e-05
Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 1/91 (1%)
Frame = +3

Query: 192 EILESYGFPSDLLPETVIAYDL-EDTGAFALDLDGSCTVNIPDAYPVKYSSVISGNIASG 368
E+L+ Y P + P Y+ E+T + + C V D+ +K+++ ++G++ G
Sbjct: 56 ELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKFTTTVTGHLEKG 115

Query: 369 SLSNLSGITVKVLFIWWNIDSISLSGDDLVF 461
L+++ GI KV+ IW + SIS + F
Sbjct: 116 KLTDVEGIKTKVM-IWVKVTSISTDASKVYF 145


>sp|Q5ZL34|CPSF6_CHICK Cleavage and polyadenylation specificity
factor subunit 6 OS=Gallus gallus GN=CPSF6 PE=2 SV=1
Length = 551

Score = 34.3 bits (77), Expect = 0.43
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = -2

Query: 482 GGGRIDMEDQVVAAEGNGINVPPDEENFDGDPTEVGEAAGRNVAGNY**VLHGVRI 315
G +ID+ D V++ N + P D + D P VG+ G+ A N G RI
Sbjct: 26 GHDQIDLYDDVISPSANNGDAPEDRDYMDSLPPSVGDDVGKGAAPNVVYTYTGKRI 81


>sp|Q5UPN3|YL167_MIMIV Uncharacterized protein L167 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_L167 PE=4 SV=1
Length = 304

Score = 33.9 bits (76), Expect = 0.57
Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 5/83 (6%)
Frame = +3

Query: 189 YEILESYGFPSDLLPETVIAYDLEDTGAFALDLDGSCTVNIPDAYPVK-----YSSVISG 353
Y+ +YG P PE + LED G D+D T N +P+K Y ++S
Sbjct: 172 YDRDTNYGIPVHTPPEEI----LEDFGKHLEDIDKLITKNYKKFFPIKKSRPAYIPIVSR 227

Query: 354 NIASGSLSNLSGITVKVLFIWWN 422
N S SNL+ V F +N
Sbjct: 228 NSESSRQSNLNSPNDSVKFNEFN 250


>sp|Q5NVH8|CPSF6_PONAB Cleavage and polyadenylation specificity
factor subunit 6 OS=Pongo abelii GN=CPSF6 PE=2 SV=1
Length = 552

Score = 33.1 bits (74), Expect = 0.97
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = -2

Query: 482 GGGRIDMEDQVVAAEGNGINVPPDEENFDGDPTEVGEAAGRNVAGNY**VLHGVRI 315
G +ID+ D V++ N + P D + D P VG+ G+ A N G RI
Sbjct: 26 GHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRI 81


>sp|Q6NVF9|CPSF6_MOUSE Cleavage and polyadenylation specificity
factor subunit 6 OS=Mus musculus GN=Cpsf6 PE=1 SV=1
Length = 551

Score = 33.1 bits (74), Expect = 0.97
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = -2

Query: 482 GGGRIDMEDQVVAAEGNGINVPPDEENFDGDPTEVGEAAGRNVAGNY**VLHGVRI 315
G +ID+ D V++ N + P D + D P VG+ G+ A N G RI
Sbjct: 26 GHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRI 81


>sp|Q16630|CPSF6_HUMAN Cleavage and polyadenylation specificity
factor subunit 6 OS=Homo sapiens GN=CPSF6 PE=1 SV=2
Length = 551

Score = 33.1 bits (74), Expect = 0.97
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = -2

Query: 482 GGGRIDMEDQVVAAEGNGINVPPDEENFDGDPTEVGEAAGRNVAGNY**VLHGVRI 315
G +ID+ D V++ N + P D + D P VG+ G+ A N G RI
Sbjct: 26 GHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRI 81


>sp|Q0P5D2|CPSF6_BOVIN Cleavage and polyadenylation specificity
factor subunit 6 OS=Bos taurus GN=CPSF6 PE=2 SV=1
Length = 551

Score = 33.1 bits (74), Expect = 0.97
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = -2

Query: 482 GGGRIDMEDQVVAAEGNGINVPPDEENFDGDPTEVGEAAGRNVAGNY**VLHGVRI 315
G +ID+ D V++ N + P D + D P VG+ G+ A N G RI
Sbjct: 26 GHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRI 81


>sp|Q7NBY8|SYA_MYCGA Alanyl-tRNA synthetase OS=Mycoplasma
gallisepticum GN=alaS PE=3 SV=2
Length = 902

Score = 31.6 bits (70), Expect = 2.8
Identities = 16/38 (42%), Positives = 22/38 (57%)
Frame = +3

Query: 180 ETAYEILESYGFPSDLLPETVIAYDLEDTGAFALDLDG 293
ET ++++E+YGFP DL+ E L LDLDG
Sbjct: 394 ETIFKLVETYGFPLDLIKE------LSAEAKIKLDLDG 425


>sp|B1M0N0|SYA_METRJ Alanyl-tRNA synthetase OS=Methylobacterium
radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)
GN=alaS PE=3 SV=1
Length = 892

Score = 31.2 bits (69), Expect = 3.7
Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
Frame = +3

Query: 174 SNETAYEILESYGFPSDLLPETVIAYDL-EDTGAFA 278
S ETA+ + ++YGFP DL + + A + DT AFA
Sbjct: 384 SGETAFTLYDTYGFPLDLTQDALKARGIGVDTDAFA 419


>sp|B0SZN4|SYA_CAUSK Alanyl-tRNA synthetase OS=Caulobacter sp.
(strain K31) GN=alaS PE=3 SV=1
Length = 883

Score = 31.2 bits (69), Expect = 3.7
Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
Frame = +3

Query: 180 ETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTV 305
ETA+++ ++YGFP DL + V A + DT F + +D T+
Sbjct: 386 ETAFKLYDTYGFPLDLTQDAVRARGITVDTDGFDVAMDRQRTM 428


tr_hit_id A7Q0F2
Definition tr|A7Q0F2|A7Q0F2_VITVI Chromosome chr7 scaffold_42, whole genome shotgun sequence OS=Vitis vinifera
Align length 120
Score (bit) 117.0
E-value 3.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921453|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_B02.
(564 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q0F2|A7Q0F2_VITVI Chromosome chr7 scaffold_42, whole genome... 117 3e-25
tr|A5B257|A5B257_VITVI Putative uncharacterized protein OS=Vitis... 115 1e-24
tr|A7PRX7|A7PRX7_VITVI Chromosome chr14 scaffold_27, whole genom... 114 3e-24
tr|B8LMI7|B8LMI7_PICSI Putative uncharacterized protein OS=Picea... 110 5e-23
tr|A9NLS0|A9NLS0_PICSI Putative uncharacterized protein OS=Picea... 110 5e-23
tr|A9RHQ8|A9RHQ8_PHYPA Predicted protein OS=Physcomitrella paten... 107 4e-22
tr|B6TTK9|B6TTK9_MAIZE Putative uncharacterized protein OS=Zea m... 105 2e-21
tr|A9PGP2|A9PGP2_POPTR Putative uncharacterized protein OS=Popul... 104 4e-21
tr|A9NSU2|A9NSU2_PICSI Putative uncharacterized protein OS=Picea... 102 2e-20
tr|A9NL33|A9NL33_PICSI Putative uncharacterized protein OS=Picea... 102 2e-20
tr|Q8LDM9|Q8LDM9_ARATH Putative uncharacterized protein OS=Arabi... 100 7e-20
tr|O81296|O81296_ARATH AT4g02370 protein OS=Arabidopsis thaliana... 100 7e-20
tr|A9PEM4|A9PEM4_POPTR Putative uncharacterized protein OS=Popul... 100 7e-20
tr|A9PCC0|A9PCC0_POPTR Putative uncharacterized protein OS=Popul... 100 9e-20
tr|A5B0Q8|A5B0Q8_VITVI Putative uncharacterized protein OS=Vitis... 99 1e-19
tr|Q2QWE5|Q2QWE5_ORYSJ Os12g0198000 protein OS=Oryza sativa subs... 99 2e-19
tr|A2ZIX0|A2ZIX0_ORYSI Putative uncharacterized protein OS=Oryza... 99 2e-19
tr|O81297|O81297_ARATH Putative uncharacterized protein AT4g0236... 98 3e-19
tr|Q60E82|Q60E82_ORYSJ Os05g0362500 protein OS=Oryza sativa subs... 97 5e-19
tr|A2Y3R5|A2Y3R5_ORYSI Putative uncharacterized protein OS=Oryza... 97 5e-19
tr|Q60E83|Q60E83_ORYSJ Os05g0362300 protein OS=Oryza sativa subs... 97 6e-19
tr|A2Y3R4|A2Y3R4_ORYSI Putative uncharacterized protein OS=Oryza... 97 6e-19
tr|Q9SRX5|Q9SRX5_ARATH F22D16.19 protein (Putative uncharacteriz... 96 1e-18
tr|A0ME53|A0ME53_ARATH Putative uncharacterized protein (Fragmen... 96 1e-18
tr|Q53M14|Q53M14_ORYSJ cDNA clone:002-181-D06, full insert seque... 95 2e-18
tr|A5B0Q6|A5B0Q6_VITVI Putative uncharacterized protein OS=Vitis... 95 2e-18
tr|A2ZCZ0|A2ZCZ0_ORYSI Putative uncharacterized protein OS=Oryza... 95 2e-18
tr|B6SIE4|B6SIE4_MAIZE Putative uncharacterized protein OS=Zea m... 95 3e-18
tr|A9NQR6|A9NQR6_PICSI Putative uncharacterized protein OS=Picea... 95 3e-18
tr|B6SJU2|B6SJU2_MAIZE Putative uncharacterized protein OS=Zea m... 94 5e-18

>tr|A7Q0F2|A7Q0F2_VITVI Chromosome chr7 scaffold_42, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028027001
PE=4 SV=1
Length = 162

Score = 117 bits (294), Expect = 3e-25
Identities = 59/120 (49%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
Frame = +3

Query: 165 SSDSNETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIPDAYPVKYSS 341
+ D + TAYEIL+SY FP LLP+ + YDL+ DTG F +GSC ++ +Y +KY S
Sbjct: 20 ADDDSPTAYEILQSYNFPMGLLPKGALGYDLDKDTGKFNAYFNGSCGFSLEGSYQLKYKS 79

Query: 342 VISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPIC 521
ISG I+ L+ LSGI+VKVLF+W NI ++ +GDD+ F V A+A++PI NF E P C
Sbjct: 80 TISGYISQNKLTKLSGISVKVLFLWLNIVEVTRNGDDMEFSVGIASAAFPIDNFFECPQC 139


>tr|A5B257|A5B257_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_014708 PE=4 SV=1
Length = 162

Score = 115 bits (289), Expect = 1e-24
Identities = 58/120 (48%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
Frame = +3

Query: 165 SSDSNETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIPDAYPVKYSS 341
+ D + TAYEIL+SY FP LLP+ + YDL+ DTG F +GSC ++ +Y +KY S
Sbjct: 20 ADDDSPTAYEILQSYNFPMGLLPKGALGYDLDKDTGKFNAYFNGSCGFSLEGSYQLKYKS 79

Query: 342 VISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPIC 521
ISG I+ L+ LSG +VKVLF+W NI ++ +GDD+ F V A+A++PI NF E P C
Sbjct: 80 TISGYISQNKLTKLSGXSVKVLFLWLNIVEVTRNGDDMEFSVGIASAAFPIDNFFECPQC 139


>tr|A7PRX7|A7PRX7_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022675001
PE=4 SV=1
Length = 170

Score = 114 bits (286), Expect = 3e-24
Identities = 57/126 (45%), Positives = 79/126 (62%), Gaps = 1/126 (0%)
Frame = +3

Query: 147 HGYRHKSSDSNETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIPDAY 323
H SS+ + T YE+L+ Y FP LLP+ VI YDL TG F+ +GSC+ ++ +Y
Sbjct: 22 HSTPASSSNDSPTVYEVLQDYNFPVGLLPKGVIGYDLNTSTGKFSASFNGSCSFSLEGSY 81

Query: 324 PVKYSSVISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNF 503
+KY S I GNI+ G LS+L G++VK+ FIW +I + SGDD+ F V A+A + I NF
Sbjct: 82 QLKYKSTIKGNISKGKLSSLEGVSVKLFFIWVDIIEVRRSGDDIDFSVGIASAGFSIDNF 141

Query: 504 SENPIC 521
E P C
Sbjct: 142 EECPQC 147


>tr|B8LMI7|B8LMI7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 157

Score = 110 bits (275), Expect = 5e-23
Identities = 54/123 (43%), Positives = 77/123 (62%), Gaps = 2/123 (1%)
Frame = +3

Query: 183 TAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIP-DAYPVKYSSVISGN 356
TAY+ L+ GFPS LLP +V Y L+ +G F++ L G C + +P D YP +S I+G
Sbjct: 35 TAYDELQRKGFPSGLLPNSVANYSLDTSSGGFSVQLQGRCDITLPPDNYPASFSEKIAGR 94

Query: 357 IASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPICDGNSR 536
+ G + +L+GI V+V F WW+I I SG DLVF V +A YP NF E+P C+G++
Sbjct: 95 LTEGYIQDLTGIRVRVFFQWWSITGIRSSGKDLVFEVGVVSAKYPSSNFDESPDCEGSNH 154

Query: 537 HAS 545
+S
Sbjct: 155 LSS 157


>tr|A9NLS0|A9NLS0_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 157

Score = 110 bits (275), Expect = 5e-23
Identities = 54/123 (43%), Positives = 77/123 (62%), Gaps = 2/123 (1%)
Frame = +3

Query: 183 TAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIP-DAYPVKYSSVISGN 356
TAY+ L+ GFPS LLP +V Y L+ +G F++ L G C + +P D YP +S I+G
Sbjct: 35 TAYDELQRKGFPSGLLPNSVANYSLDTSSGGFSVQLQGRCDITLPPDNYPASFSDKIAGR 94

Query: 357 IASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPICDGNSR 536
+ G + +L+GI V+V F WW+I I SG DLVF V +A YP NF E+P C+G++
Sbjct: 95 LTEGYIQDLTGIRVRVFFQWWSITGIRSSGKDLVFEVGVVSAKYPSSNFDESPDCEGSNH 154

Query: 537 HAS 545
+S
Sbjct: 155 LSS 157


>tr|A9RHQ8|A9RHQ8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175070 PE=4 SV=1
Length = 160

Score = 107 bits (267), Expect = 4e-22
Identities = 54/120 (45%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
Frame = +3

Query: 165 SSDSNETAYEILESYGFPSDLLPETVIAYDLEDTGAFALDLDGSCTVNIPDAYPVKYSSV 344
SSD+++ YE LE++GFP LLP TV Y LE +G F L L+G C V I D YP+ Y V
Sbjct: 25 SSDASDV-YEKLETFGFPEGLLPHTVTNYILEPSGKFTLYLEGRCPVLIEDKYPLIYDKV 83

Query: 345 ISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGD-DLVFHVDPATASYPILNFSENPIC 521
I+G ++ G L L GI+VK ++WW+I I+L D L F + +A +P NF + P+C
Sbjct: 84 ITGMLSYGRLQGLKGISVKAYYVWWSITGIALGDDHSLFFEIGILSARFPYNNFDDPPVC 143


>tr|B6TTK9|B6TTK9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 166

Score = 105 bits (261), Expect = 2e-21
Identities = 51/132 (38%), Positives = 80/132 (60%)
Frame = +3

Query: 150 GYRHKSSDSNETAYEILESYGFPSDLLPETVIAYDLEDTGAFALDLDGSCTVNIPDAYPV 329
G ++S TAYE+LE YGFP +LP V Y+L GAF + +C + + V
Sbjct: 32 GNATETSPPPPTAYEMLERYGFPRGILPAGVTGYELGADGAFEVYFPRACEFLLARTWLV 91

Query: 330 KYSSVISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSE 509
+Y + +SG++A+GSL+ L GI+VKVLF+W + + +G+ L F++ P S+PI +F+E
Sbjct: 92 RYEARVSGSVAAGSLTALRGISVKVLFLWLGVGEVDRAGETLSFYIGPVATSFPIDDFAE 151

Query: 510 NPICDGNSRHAS 545
+P C G A+
Sbjct: 152 SPRCRGYDAEAA 163


>tr|A9PGP2|A9PGP2_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 150

Score = 104 bits (259), Expect = 4e-21
Identities = 55/122 (45%), Positives = 73/122 (59%), Gaps = 2/122 (1%)
Frame = +3

Query: 186 AYEILESYGFPSDLLPETVIAYDLEDT-GAFALDLDGSCTVNIP-DAYPVKYSSVISGNI 359
A+ L +YGFP LLP +V Y T G F++DL +C + +P D Y YS +SG I
Sbjct: 30 AHTELTNYGFPIGLLPSSVKNYTFNQTSGEFSVDLGSACKITLPPDNYLATYSKRVSGKI 89

Query: 360 ASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPICDGNSRH 539
G ++ L GI V+ F WW+I IS SGD+LVF V TA YP NF E+P C+G +H
Sbjct: 90 VEGRIAELDGIRVRAFFKWWSITGISSSGDNLVFEVGMITAKYPSKNFDESPQCEG--KH 147

Query: 540 AS 545
+S
Sbjct: 148 SS 149


>tr|A9NSU2|A9NSU2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 159

Score = 102 bits (253), Expect = 2e-20
Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 1/119 (0%)
Frame = +3

Query: 168 SDSNETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIPDAYPVKYSSV 344
S +AY +LE +GFP +LP AY L D G+F ++L+ C++++ Y +KY S
Sbjct: 26 SSEQLSAYTVLEQFGFPRGILPANAGAYTLNSDDGSFVINLESPCSLDLDSGYQLKYRSQ 85

Query: 345 ISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPIC 521
I+G I +G++ L+G++VKVLF W +ID GD+L+F+V +AS+P+ NF P C
Sbjct: 86 ITGRIEAGAIRKLTGVSVKVLFFWVSIDEAIRDGDELLFYVGVVSASFPVSNFYICPEC 144


>tr|A9NL33|A9NL33_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 159

Score = 102 bits (253), Expect = 2e-20
Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 1/119 (0%)
Frame = +3

Query: 168 SDSNETAYEILESYGFPSDLLPETVIAYDLE-DTGAFALDLDGSCTVNIPDAYPVKYSSV 344
S +AY +LE +GFP +LP AY L D G+F ++L+ C++++ Y +KY S
Sbjct: 26 SSEQLSAYTVLEQFGFPRGILPANAGAYTLNSDDGSFVINLESPCSLDLDSGYQLKYRSQ 85

Query: 345 ISGNIASGSLSNLSGITVKVLFIWWNIDSISLSGDDLVFHVDPATASYPILNFSENPIC 521
I+G I +G++ L+G++VKVLF W +ID GD+L+F+V +AS+P+ NF P C
Sbjct: 86 ITGRIETGAIRKLTGVSVKVLFFWVSIDEAIRDGDELLFYVGVVSASFPVSNFYICPEC 144