BP921474
Clone id YMU001_000150_D03
Library
Length 347
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000150_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGACACCCAGCTTTGATGGTCGCGACATGGGAACTCTGGAGTGTGTTTTTACAGTGAGA
AGCCATATCAAAATGCAGAGTTTTTCATGGATGGCATTCCATGCATTGTCCCTCTGCTGA
GGCTTCATCACAAGATAAAGAAGAAAATACAGGCATTTTCGAAGTATAATATCGTATAGG
TTGTCAGCATTTGTGCCAGACCAAATATTGTTAAAGTTAGTAGCTAGCGTTCGGATCTAG
CTAAATATGTCGTATTAGACATCTGGAAATTAGAGCGGAAGGTCAATAGCAAAGTCCGAT
AAGCCAAAAGCTGGGATTTTTGAAGCTAATTTCGAAGGGAAACGGTC
■■Homology search results ■■ -
sp_hit_id Q09537
Definition sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans
Align length 59
Score (bit) 32.3
E-value 0.75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921474|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_D03.
(347 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caen... 32 0.75
sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=2 SV=1 31 1.7
sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1 OS=Caen... 29 6.3
sp|P68527|ATP6_WHEAT ATP synthase subunit a OS=Triticum aestivum... 29 6.3
sp|P68526|ATP6_TRITI ATP synthase subunit a OS=Triticum timophee... 29 6.3
sp|Q9BXP8|PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens GN=PAPPA2 PE=... 29 8.3

>sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1
OS=Caenorhabditis elegans GN=grk-1 PE=2 SV=1
Length = 642

Score = 32.3 bits (72), Expect = 0.75
Identities = 18/59 (30%), Positives = 27/59 (45%)
Frame = +2

Query: 32 ELWSVFLQ*EAISKCRVFHGWHSMHCPSAEASSQDKEENTGIFEV*YRIGCQHLCQTKY 208
E W FL E IS C +A++++ D E + IF YR+ CQ+L +
Sbjct: 127 EFWCSFLSDEVISTC----------ITTADSATHDDEPRSDIFTEPYRLTCQYLTDAPF 175


>sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=2 SV=1
Length = 365

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/44 (36%), Positives = 22/44 (50%)
Frame = -1

Query: 200 SGTNADNLYDIILRKCLYFLLYLVMKPQQRDNAWNAIHEKLCIL 69
SG N N+ D + CLYF+ P R A+HEK+ I+
Sbjct: 122 SGLNRKNIQDSRVHCCLYFISPFGRAPAPRCGFLRAVHEKVNII 165


>sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1
OS=Caenorhabditis briggsae GN=grk-1 PE=3 SV=1
Length = 640

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/59 (28%), Positives = 28/59 (47%)
Frame = +2

Query: 32 ELWSVFLQ*EAISKCRVFHGWHSMHCPSAEASSQDKEENTGIFEV*YRIGCQHLCQTKY 208
E+W FL E IS C +A++++ D E + IF YR+ ++L Q +
Sbjct: 126 EVWCAFLSDEVISTC----------ISTADSATHDSEPRSDIFSEPYRLTREYLKQKPF 174


>sp|P68527|ATP6_WHEAT ATP synthase subunit a OS=Triticum aestivum
GN=ATP6 PE=3 SV=1
Length = 386

Score = 29.3 bits (64), Expect = 6.3
Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 3/77 (3%)
Frame = -1

Query: 305 GLSDFAIDLPL*FPDV*YDIFS*IRTLATNFNNIWSGTNADNLYDIILRKCLYFLLYLVM 126
G+ +F +LP +P+ D F+ I + + N + + LY ++ + FL ++V
Sbjct: 113 GMDNFIQNLPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVT 172

Query: 125 KP---QQRDNAWNAIHE 84
K + NAW ++ E
Sbjct: 173 KKGGGKSVPNAWQSLVE 189


>sp|P68526|ATP6_TRITI ATP synthase subunit a OS=Triticum timopheevi
GN=ATP6 PE=3 SV=1
Length = 386

Score = 29.3 bits (64), Expect = 6.3
Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 3/77 (3%)
Frame = -1

Query: 305 GLSDFAIDLPL*FPDV*YDIFS*IRTLATNFNNIWSGTNADNLYDIILRKCLYFLLYLVM 126
G+ +F +LP +P+ D F+ I + + N + + LY ++ + FL ++V
Sbjct: 113 GMDNFIQNLPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVT 172

Query: 125 KP---QQRDNAWNAIHE 84
K + NAW ++ E
Sbjct: 173 KKGGGKSVPNAWQSLVE 189


>sp|Q9BXP8|PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens GN=PAPPA2 PE=1
SV=4
Length = 1791

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/44 (31%), Positives = 19/44 (43%)
Frame = -3

Query: 135 SCDEASAEGQCMECHP*KTLHFDMASHCKNTLQSSHVATIKAGC 4
SC+ A+G C + H+D C +TL S V A C
Sbjct: 1732 SCEPFQADGWCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADC 1775


tr_hit_id Q8IES7
Definition tr|Q8IES7|Q8IES7_PLAF7 Putative uncharacterized protein MAL13P1.19 OS=Plasmodium falciparum (isolate 3D7)
Align length 55
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921474|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_D03.
(347 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8IES7|Q8IES7_PLAF7 Putative uncharacterized protein MAL13P1.... 34 3.2

>tr|Q8IES7|Q8IES7_PLAF7 Putative uncharacterized protein MAL13P1.19
OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.19 PE=4
SV=1
Length = 9271

Score = 34.3 bits (77), Expect = 3.2
Identities = 15/55 (27%), Positives = 32/55 (58%)
Frame = -1

Query: 200 SGTNADNLYDIILRKCLYFLLYLVMKPQQRDNAWNAIHEKLCILIWLLTVKTHSR 36
S N N+Y++ + KC++ +LY+++ + R+N +H CI L+ K +++
Sbjct: 5800 SCVNYINIYNMNVIKCIHKILYVLILYESRENICKNLHMITCIFFLLMNNKVNNK 5854