BP921477
Clone id YMU001_000150_D06
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000150_D06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCAATCCGACTTGGGTTCTCAGTTCTTCTTCTTCAGACAGTCCATGGCGGGAGATCAAGT
ACCTGTCGCAGTAAAAGAAGCAAAGTGTGATTTTTGTGAGGAGAGGCCCGCGTTCTTATA
TTGTAAACCAGACTCAGCTCGACTCTGCTTGCTATGCGACCATCATGTGCATTCAGCAAA
CCCTCTCTCCCTGAAGCATTCGAGGTCTCCCTTGTGTGAATGCTGTGGGGAACGTTCTGC
AACATTGCAATGCGAGGAGGAGGCACGGTTTTTTTGTGCTACTTGTGAACAAAGTGCACA
CAATGGTGAGGGACATACACTTGTCAAAGCCAGTACTTTTAGTGGTTGCCTTGTACCTTC
TCAAGTAGCTTCTGCTTGGAAATGCCATGCTCCCAACCTTTTCCCAGACAATTTCCTGCT
TAGCCGAGGTGCAGCACTTGACAATCTGTGCTGGACTTCGGATGGTTCTCTTGGCAGCAT
CCTTGCCTCACCTTGGATAAGCGGCTTTGATTCATTTTCGTTGTCAGATTCTAACTCATA
CTCTGGAGACATTTCAGCCTCTTCAGAACGTCTTTTGGTAAGTCATTGTACTATGTG
■■Homology search results ■■ -
sp_hit_id O23379
Definition sp|O23379|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11 OS=Arabidopsis thaliana
Align length 103
Score (bit) 100.0
E-value 7.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921477|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_D06.
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O23379|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE... 100 7e-21
sp|Q9SSE5|COL9_ARATH Zinc finger protein CONSTANS-LIKE 9 OS=Arab... 95 3e-19
sp|Q9LUA9|COL10_ARATH Zinc finger protein CONSTANS-LIKE 10 OS=Ar... 94 5e-19
sp|Q9LJ44|COL12_ARATH Putative zinc finger protein CONSTANS-LIKE... 94 7e-19
sp|Q9C7E8|COL15_ARATH Zinc finger protein CONSTANS-LIKE 15 OS=Ar... 90 1e-17
sp|O22800|COL14_ARATH Zinc finger protein CONSTANS-LIKE 14 OS=Ar... 88 3e-17
sp|O82256|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13 OS=Ar... 86 2e-16
sp|Q940T9|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4 OS=Arab... 79 2e-14
sp|Q9C9F4|COLX_ARATH Putative zinc finger protein At1g68190 OS=A... 77 7e-14
sp|Q9LQZ7|STHX_ARATH Putative salt tolerance-like protein At1g75... 75 2e-13
sp|Q9SK53|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3 OS=Arab... 73 1e-12
sp|Q9SID1|STH_ARATH Salt tolerance-like protein OS=Arabidopsis t... 69 2e-11
sp|Q39057|CONS_ARATH Zinc finger protein CONSTANS OS=Arabidopsis... 69 2e-11
sp|O50055|COL1_ARATH Zinc finger protein CONSTANS-LIKE 1 OS=Arab... 69 2e-11
sp|Q96288|STO_ARATH Salt tolerance protein OS=Arabidopsis thalia... 69 2e-11
sp|Q96502|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2 OS=Arab... 66 1e-10
sp|Q9FHH8|COL5_ARATH Zinc finger protein CONSTANS-LIKE 5 OS=Arab... 61 5e-09
sp|Q9SYM2|STHY_ARATH Putative salt tolerance-like protein At1g78... 60 6e-09
sp|Q8RWD0|COL16_ARATH Zinc finger protein CONSTANS-LIKE 16 OS=Ar... 50 1e-05
sp|Q8LG76|COL6_ARATH Zinc finger protein CONSTANS-LIKE 6 OS=Arab... 49 1e-05
sp|Q09654|ARD1_CAEEL Putative GTP-binding protein ard-1 homolog ... 46 1e-04
sp|Q9M9B3|COL8_ARATH Putative zinc finger protein CONSTANS-LIKE ... 46 2e-04
sp|Q9C9A9|COL7_ARATH Zinc finger protein CONSTANS-LIKE 7 OS=Arab... 42 0.003
sp|P36407|ARD1_RAT GTP-binding protein ARD-1 (Fragment) OS=Rattu... 41 0.004
sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 OS=Mus musculus G... 40 0.012
sp|P36406|ARD1_HUMAN GTP-binding protein ARD-1 OS=Homo sapiens G... 38 0.044
sp|Q8K3T2|PER2_SPAJD Period circadian protein homolog 2 OS=Spala... 35 0.37
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanog... 34 0.49
sp|A2C155|SYT_PROM1 Threonyl-tRNA synthetase OS=Prochlorococcus ... 34 0.49
sp|A1U2C3|SYT_MARAV Threonyl-tRNA synthetase OS=Marinobacter aqu... 33 1.1

>sp|O23379|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11
OS=Arabidopsis thaliana GN=COL11 PE=2 SV=2
Length = 330

Score = 100 bits (248), Expect = 7e-21
Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 2/103 (1%)
Frame = +2

Query: 77 EAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCE 256
EA+CDFC A +YCK DSA+LCL CD +VHSANPLS +H+RS LCE C + + C
Sbjct: 2 EARCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLLCEKCSLQPTAVHCM 61

Query: 257 EEARFFCATCEQSAHN--GEGHTLVKASTFSGCLVPSQVASAW 379
E C C+ +A N G GH L + +S C PS W
Sbjct: 62 NENVSLCQGCQWTASNCTGLGHRLQSLNPYSDCPSPSDFGKIW 104


>sp|Q9SSE5|COL9_ARATH Zinc finger protein CONSTANS-LIKE 9
OS=Arabidopsis thaliana GN=COL9 PE=2 SV=1
Length = 372

Score = 94.7 bits (234), Expect = 3e-19
Identities = 46/111 (41%), Positives = 62/111 (55%), Gaps = 13/111 (11%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ D+A LCL CD VHSAN LS +HSR+ +CE C + AT++C EE
Sbjct: 5 CDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRCVEER 64

Query: 266 RFFCATCEQSAHNG-------------EGHTLVKASTFSGCLVPSQVASAW 379
C C+ S HN + H S +SGC S++AS W
Sbjct: 65 VSLCQNCDWSGHNNSNNNNSSSSSTSPQQHKRQTISCYSGCPSSSELASIW 115



Score = 34.3 bits (77), Expect = 0.49
Identities = 10/31 (32%), Positives = 20/31 (64%)
Frame = +2

Query: 212 LCECCGERSATLQCEEEARFFCATCEQSAHN 304
+C+ CGE+ + + C +A C +C++S H+
Sbjct: 4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHS 34


>sp|Q9LUA9|COL10_ARATH Zinc finger protein CONSTANS-LIKE 10
OS=Arabidopsis thaliana GN=COL10 PE=2 SV=1
Length = 373

Score = 94.0 bits (232), Expect = 5e-19
Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 6/104 (5%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ D+A LCL CD +VHSAN LS +HSR+ +CE C + A+++C +E
Sbjct: 5 CDFCGEQRSMVYCRSDAACLCLSCDRNVHSANALSKRHSRTLVCERCNAQPASVRCSDER 64

Query: 266 RFFCATCEQSAHNGEGHTLVK------ASTFSGCLVPSQVASAW 379
C C+ S H+G+ T + +SGC ++++S W
Sbjct: 65 VSLCQNCDWSGHDGKNSTTTSHHKRQTINCYSGCPSSAELSSIW 108



Score = 33.1 bits (74), Expect = 1.1
Identities = 9/31 (29%), Positives = 20/31 (64%)
Frame = +2

Query: 212 LCECCGERSATLQCEEEARFFCATCEQSAHN 304
+C+ CGE+ + + C +A C +C+++ H+
Sbjct: 4 MCDFCGEQRSMVYCRSDAACLCLSCDRNVHS 34


>sp|Q9LJ44|COL12_ARATH Putative zinc finger protein CONSTANS-LIKE 12
OS=Arabidopsis thaliana GN=COL12 PE=3 SV=1
Length = 337

Score = 93.6 bits (231), Expect = 7e-19
Identities = 45/103 (43%), Positives = 57/103 (55%), Gaps = 2/103 (1%)
Frame = +2

Query: 77 EAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCE 256
E KCD C A +YCK D A+LCL CD HVHSANPLS +H RS +CE C + A ++C
Sbjct: 2 EPKCDHCATSQALIYCKSDLAKLCLNCDVHVHSANPLSHRHIRSLICEKCFSQPAAIRCL 61

Query: 257 EEARFFCATCEQSAHNGE--GHTLVKASTFSGCLVPSQVASAW 379
+E +C C N GH + + FSGC P+ W
Sbjct: 62 DEKVSYCQGCHWHESNCSELGHRVQSLNPFSGCPSPTDFNRMW 104


>sp|Q9C7E8|COL15_ARATH Zinc finger protein CONSTANS-LIKE 15
OS=Arabidopsis thaliana GN=COL15 PE=2 SV=1
Length = 433

Score = 89.7 bits (221), Expect = 1e-17
Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC ER A L+C+ D+A+LCL CD VH+AN LS KH RS +C+ CG +++C +
Sbjct: 9 CDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNCGNEPVSVRCFTDN 68

Query: 266 RFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
C C+ H + H FSGC ++A+ W
Sbjct: 69 LILCQECDWDVHGSCSVSDAHVRSAVEGFSGCPSALELAALW 110



Score = 34.3 bits (77), Expect = 0.49
Identities = 17/46 (36%), Positives = 22/46 (47%)
Frame = +2

Query: 71 VKEAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRS 208
V+ CD C P + C D+ LC CD VH + +S H RS
Sbjct: 47 VRSQICDNCGNEPVSVRCFTDNLILCQECDWDVHGSCSVSDAHVRS 92


>sp|O22800|COL14_ARATH Zinc finger protein CONSTANS-LIKE 14
OS=Arabidopsis thaliana GN=COL14 PE=2 SV=2
Length = 402

Score = 88.2 bits (217), Expect = 3e-17
Identities = 40/102 (39%), Positives = 57/102 (55%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
C+FC ER A L+C+ D+A+LCL CD HVHSAN LS KH RS +C+ C + +++C +
Sbjct: 12 CEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQICDNCSKEPVSVRCFTDN 71

Query: 266 RFFCATCEQSAH----NGEGHTLVKASTFSGCLVPSQVASAW 379
C C+ H + H FSGC ++A+ W
Sbjct: 72 LVLCQECDWDVHGSCSSSATHERSAVEGFSGCPSVLELAAVW 113



Score = 36.2 bits (82), Expect = 0.13
Identities = 17/46 (36%), Positives = 22/46 (47%)
Frame = +2

Query: 71 VKEAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRS 208
V+ CD C + P + C D+ LC CD VH + S H RS
Sbjct: 50 VRSQICDNCSKEPVSVRCFTDNLVLCQECDWDVHGSCSSSATHERS 95


>sp|O82256|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13
OS=Arabidopsis thaliana GN=COL13 PE=2 SV=1
Length = 332

Score = 85.5 bits (210), Expect = 2e-16
Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
Frame = +2

Query: 74 KEAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQC 253
++ CD+C+ A +YCK DSA+LCL CD VH AN L KH RS LC+ C E ++L C
Sbjct: 9 RDRLCDYCDSSVALVYCKADSAKLCLACDKQVHVANQLFAKHFRSLLCDSCNESPSSLFC 68

Query: 254 EEEARFFCATCEQSAHNGEG--HTLVKASTFSGC 349
E E C C+ H H+ F+GC
Sbjct: 69 ETERSVLCQNCDWQHHTASSSLHSRRPFEGFTGC 102



Score = 30.8 bits (68), Expect = 5.4
Identities = 10/35 (28%), Positives = 17/35 (48%)
Frame = +2

Query: 197 HSRSPLCECCGERSATLQCEEEARFFCATCEQSAH 301
H R LC+ C A + C+ ++ C C++ H
Sbjct: 7 HQRDRLCDYCDSSVALVYCKADSAKLCLACDKQVH 41


>sp|Q940T9|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4
OS=Arabidopsis thaliana GN=COL4 PE=2 SV=2
Length = 362

Score = 79.0 bits (193), Expect = 2e-14
Identities = 32/73 (43%), Positives = 47/73 (64%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CD C+ A LYC+PD+A LCL CD VH+AN L+ +H+R +CE C + A + C+ +A
Sbjct: 6 CDSCKSATAALYCRPDAAFLCLSCDSKVHAANKLASRHARVWMCEVCEQAPAHVTCKADA 65

Query: 266 RFFCATCEQSAHN 304
C TC++ H+
Sbjct: 66 AALCVTCDRDIHS 78



Score = 60.5 bits (145), Expect = 6e-09
Identities = 29/76 (38%), Positives = 41/76 (53%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
C+ CE+ PA + CK D+A LC+ CD +HSANPL+ +H R P+ S+ + A
Sbjct: 49 CEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLARRHERVPVTPFYDSVSSDGSVKHTA 108

Query: 266 RFFCATCEQSAHNGEG 313
F C S +G G
Sbjct: 109 VNFLDDCYFSDIDGNG 124



Score = 37.0 bits (84), Expect = 0.075
Identities = 24/91 (26%), Positives = 34/91 (37%)
Frame = +2

Query: 206 SPLCECCGERSATLQCEEEARFFCATCEQSAHNGEGHTLVKASTFSGCLVPSQVASAWKC 385
S LC+ C +A L C +A F C +C+ H + + S+ A W C
Sbjct: 3 SKLCDSCKSATAALYCRPDAAFLCLSCDSKVH-------------AANKLASRHARVWMC 49

Query: 386 HAPNLFPDNFLLSRGAALDNLCWTSDGSLGS 478
P + AA LC T D + S
Sbjct: 50 EVCEQAPAHVTCKADAAA--LCVTCDRDIHS 78


>sp|Q9C9F4|COLX_ARATH Putative zinc finger protein At1g68190
OS=Arabidopsis thaliana GN=At1g68190 PE=2 SV=1
Length = 356

Score = 77.0 bits (188), Expect = 7e-14
Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
Frame = +2

Query: 77 EAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCE 256
E C+FC+ A +YC D+A LCL CD VHSAN LS +H R+ LC+ C + ++C
Sbjct: 11 ERVCEFCKAYRAVVYCIADTANLCLTCDAKVHSANSLSGRHLRTVLCDSCKNQPCVVRCF 70

Query: 257 EEARFFCATCEQSAHNG--EGHTLVKASTFSGCLVPSQVASAW 379
+ F C C H G H ++GC A W
Sbjct: 71 DHKMFLCHGCNDKFHGGGSSEHRRRDLRCYTGCPPAKDFAVMW 113


>sp|Q9LQZ7|STHX_ARATH Putative salt tolerance-like protein At1g75540
OS=Arabidopsis thaliana GN=At1g75540 PE=1 SV=1
Length = 331

Score = 75.5 bits (184), Expect = 2e-13
Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 12/91 (13%)
Frame = +2

Query: 83 KCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSR------------SPLCECC 226
+CD C++ A ++C D A LC CDH VH AN L+ KH R SPLC+ C
Sbjct: 4 RCDVCDKEEASVFCTADEASLCGGCDHQVHHANKLASKHLRFSLLYPSSSNTSSPLCDIC 63

Query: 227 GERSATLQCEEEARFFCATCEQSAHNGEGHT 319
++ A L C+++ C C+ S H HT
Sbjct: 64 QDKKALLFCQQDRAILCKDCDSSIHAANEHT 94



Score = 47.0 bits (110), Expect = 7e-05
Identities = 18/40 (45%), Positives = 26/40 (65%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSR 205
CD C+++ A L+C+ D A LC CD +H+AN + KH R
Sbjct: 60 CDICQDKKALLFCQQDRAILCKDCDSSIHAANEHTKKHDR 99


tr_hit_id A9NUQ9
Definition tr|A9NUQ9|A9NUQ9_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 143
Score (bit) 100.0
E-value 5.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921477|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_D06.
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUQ9|A9NUQ9_PICSI Putative uncharacterized protein OS=Picea... 100 5e-20
tr|A7QUS4|A7QUS4_VITVI Chromosome chr1 scaffold_180, whole genom... 95 3e-18
tr|A5X2T0|A5X2T0_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 95 3e-18
tr|A5X2S8|A5X2S8_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 95 3e-18
tr|A5X2R8|A5X2R8_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 95 3e-18
tr|A5X2R7|A5X2R7_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 95 3e-18
tr|A1A6H1|A1A6H1_ARATH At3g07650 OS=Arabidopsis thaliana PE=2 SV=1 95 3e-18
tr|Q6Z1G2|Q6Z1G2_ORYSJ Zinc-finger protein C60910-like OS=Oryza ... 93 1e-17
tr|Q0J438|Q0J438_ORYSJ Os08g0536300 protein (Fragment) OS=Oryza ... 93 1e-17
tr|A7Q2W9|A7Q2W9_VITVI Chromosome chr12 scaffold_47, whole genom... 93 1e-17
tr|A5X2S9|A5X2S9_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 93 1e-17
tr|A7PA06|A7PA06_VITVI Chromosome chr14 scaffold_9, whole genome... 93 1e-17
tr|A5C9I4|A5C9I4_VITVI Putative uncharacterized protein OS=Vitis... 93 1e-17
tr|A7R4C1|A7R4C1_VITVI Chromosome undetermined scaffold_648, who... 92 2e-17
tr|A9RSK1|A9RSK1_PHYPA Predicted protein OS=Physcomitrella paten... 92 2e-17
tr|Q0DCR8|Q0DCR8_ORYSJ Os06g0298200 protein OS=Oryza sativa subs... 91 4e-17
tr|B7EN35|B7EN35_ORYSJ cDNA clone:J013001A08, full insert sequen... 91 4e-17
tr|A9RZ12|A9RZ12_PHYPA Predicted protein OS=Physcomitrella paten... 91 4e-17
tr|A3AAW2|A3AAW2_ORYSJ Putative uncharacterized protein OS=Oryza... 91 4e-17
tr|O82118|O82118_ORYSJ Os02g0724000 protein OS=Oryza sativa subs... 91 5e-17
tr|B8AHP4|B8AHP4_ORYSI Putative uncharacterized protein OS=Oryza... 91 7e-17
tr|B6TCQ2|B6TCQ2_MAIZE CCT motif family protein OS=Zea mays PE=2... 91 7e-17
tr|A5X2R6|A5X2R6_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2 ... 90 9e-17
tr|B7FIW6|B7FIW6_MEDTR Putative uncharacterized protein OS=Medic... 89 2e-16
tr|Q3EBP2|Q3EBP2_ARATH Uncharacterized protein At2g33500.2 OS=Ar... 88 3e-16
tr|A9TI68|A9TI68_PHYPA Predicted protein (Fragment) OS=Physcomit... 87 6e-16
tr|B4FE60|B4FE60_MAIZE Putative uncharacterized protein OS=Zea m... 86 2e-15
tr|Q3EBE4|Q3EBE4_ARATH Uncharacterized protein At2g47890.2 OS=Ar... 86 2e-15
tr|A7P100|A7P100_VITVI Chromosome chr19 scaffold_4, whole genome... 84 5e-15
tr|A7PTY7|A7PTY7_VITVI Chromosome chr7 scaffold_31, whole genome... 80 7e-14

>tr|A9NUQ9|A9NUQ9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 555

Score = 100 bits (250), Expect = 5e-20
Identities = 50/143 (34%), Positives = 76/143 (53%), Gaps = 5/143 (3%)
Frame = +2

Query: 77 EAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCE 256
+ CDFC E + +YC+ DSA LCL CD H+H AN LS +H R+ LC+ C A C
Sbjct: 2 DTMCDFCGEIRSTVYCRADSASLCLSCDEHIHGANALSKRHLRTVLCDGCSVEPAAFSCN 61

Query: 257 EEARFFCATCEQSAH-NGEGHTLVKASTFSGCLVPSQVASAWKCHAPNLFPDNFLLSRGA 433
+ FC C++ +H N H S ++GC +++A W C L D+ +G
Sbjct: 62 DHKLSFCHNCDRQSHSNSPQHRRKSISYYTGCPSAAELAELWDCELDRLGGDD---QQGP 118

Query: 434 ALDNLCWTS----DGSLGSILAS 490
++ + W + +GSL ++LAS
Sbjct: 119 SVPGIGWGNSGGENGSLETLLAS 141


>tr|A7QUS4|A7QUS4_VITVI Chromosome chr1 scaffold_180, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00006960001
PE=4 SV=1
Length = 431

Score = 95.1 bits (235), Expect = 3e-18
Identities = 46/114 (40%), Positives = 60/114 (52%), Gaps = 4/114 (3%)
Frame = +2

Query: 50 GDQVPVAVKEAKCDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCG 229
G++VP CDFC + A LYC+ DSA+LCL CD HVHSAN LS KH RS +C+ C
Sbjct: 9 GERVP-------CDFCSGQIAVLYCRADSAKLCLFCDQHVHSANALSRKHLRSQICDNCS 61

Query: 230 ERSATLQCEEEARFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
+++C + C C+ AH H FSGC Q++S W
Sbjct: 62 SEPVSVRCSTDNMVLCQECDWDAHGSCSVSAAHDRKPVEGFSGCPSAVQLSSIW 115


>tr|A5X2T0|A5X2T0_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2
PE=2 SV=1
Length = 366

Score = 94.7 bits (234), Expect = 3e-18
Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ DSA LCL CD +VHSAN LS +HSR+ LCE C + A ++C EE
Sbjct: 5 CDFCSEQRSMVYCRSDSACLCLSCDRNVHSANALSKRHSRTLLCEKCNSQPAFVRCVEEK 64

Query: 266 RFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
FC C+ HN H + +SGC ++++ W
Sbjct: 65 TSFCQNCDWLGHNVSEEASTHKKQAVNCYSGCPSSAELSMIW 106


>tr|A5X2S8|A5X2S8_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2
PE=2 SV=1
Length = 331

Score = 94.7 bits (234), Expect = 3e-18
Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ DSA LCL CD +VHSAN LS +HSR+ LCE C + A ++C EE
Sbjct: 5 CDFCSEQRSMVYCRSDSACLCLSCDRNVHSANALSKRHSRTLLCEKCNSQPAFVRCVEEK 64

Query: 266 RFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
FC C+ HN H + +SGC ++++ W
Sbjct: 65 TSFCQNCDWLGHNVSEEASTHKKQAVNCYSGCPSSAELSMIW 106


>tr|A5X2R8|A5X2R8_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2
PE=4 SV=1
Length = 366

Score = 94.7 bits (234), Expect = 3e-18
Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ DSA LCL CD +VHSAN LS +HSR+ LCE C + A ++C EE
Sbjct: 5 CDFCSEQRSMVYCRSDSACLCLSCDRNVHSANALSKRHSRTLLCEKCNSQPAFVRCVEEK 64

Query: 266 RFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
FC C+ HN H + +SGC ++++ W
Sbjct: 65 TSFCQNCDWLGHNVSEEASTHKKQAVNCYSGCPSSAELSMIW 106


>tr|A5X2R7|A5X2R7_9ERIC SLL2 protein OS=Primula vulgaris GN=SLL2
PE=4 SV=1
Length = 366

Score = 94.7 bits (234), Expect = 3e-18
Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ DSA LCL CD +VHSAN LS +HSR+ LCE C + A ++C EE
Sbjct: 5 CDFCSEQRSMVYCRSDSACLCLSCDRNVHSANALSKRHSRTLLCEKCNSQPAFVRCVEEK 64

Query: 266 RFFCATCEQSAHN----GEGHTLVKASTFSGCLVPSQVASAW 379
FC C+ HN H + +SGC ++++ W
Sbjct: 65 TSFCQNCDWLGHNVSEEASTHKKQAVNCYSGCPSSAELSMIW 106


>tr|A1A6H1|A1A6H1_ARATH At3g07650 OS=Arabidopsis thaliana PE=2 SV=1
Length = 372

Score = 94.7 bits (234), Expect = 3e-18
Identities = 46/111 (41%), Positives = 62/111 (55%), Gaps = 13/111 (11%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ D+A LCL CD VHSAN LS +HSR+ +CE C + AT++C EE
Sbjct: 5 CDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRCVEER 64

Query: 266 RFFCATCEQSAHNG-------------EGHTLVKASTFSGCLVPSQVASAW 379
C C+ S HN + H S +SGC S++AS W
Sbjct: 65 VSLCQNCDWSGHNNSNNNNSSSSSTSPQQHKRQTISCYSGCPSSSELASIW 115



Score = 34.3 bits (77), Expect = 5.6
Identities = 10/31 (32%), Positives = 20/31 (64%)
Frame = +2

Query: 212 LCECCGERSATLQCEEEARFFCATCEQSAHN 304
+C+ CGE+ + + C +A C +C++S H+
Sbjct: 4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHS 34


>tr|Q6Z1G2|Q6Z1G2_ORYSJ Zinc-finger protein C60910-like OS=Oryza
sativa subsp. japonica GN=OSJNBa0033D24.33 PE=4 SV=1
Length = 488

Score = 93.2 bits (230), Expect = 1e-17
Identities = 44/106 (41%), Positives = 60/106 (56%), Gaps = 3/106 (2%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CD+C E A L+C+ D+ARLC+ CD HVH+AN LS KH R+PLC C R A + +
Sbjct: 18 CDYCGEAAAALHCRADAARLCVACDRHVHAANALSRKHVRAPLCAACAARPAAARVASAS 77

Query: 266 --RFFCATCEQSAHNGEGHTL-VKASTFSGCLVPSQVASAWKCHAP 394
F CA C+ +G L V FSGC +++A++W P
Sbjct: 78 APAFLCADCDTGCGGDDGAALRVPVEGFSGCPAAAELAASWGLDLP 123


>tr|Q0J438|Q0J438_ORYSJ Os08g0536300 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os08g0536300 PE=4 SV=1
Length = 525

Score = 93.2 bits (230), Expect = 1e-17
Identities = 44/106 (41%), Positives = 60/106 (56%), Gaps = 3/106 (2%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CD+C E A L+C+ D+ARLC+ CD HVH+AN LS KH R+PLC C R A + +
Sbjct: 55 CDYCGEAAAALHCRADAARLCVACDRHVHAANALSRKHVRAPLCAACAARPAAARVASAS 114

Query: 266 --RFFCATCEQSAHNGEGHTL-VKASTFSGCLVPSQVASAWKCHAP 394
F CA C+ +G L V FSGC +++A++W P
Sbjct: 115 APAFLCADCDTGCGGDDGAALRVPVEGFSGCPAAAELAASWGLDLP 160


>tr|A7Q2W9|A7Q2W9_VITVI Chromosome chr12 scaffold_47, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029061001
PE=4 SV=1
Length = 405

Score = 93.2 bits (230), Expect = 1e-17
Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 4/102 (3%)
Frame = +2

Query: 86 CDFCEERPAFLYCKPDSARLCLLCDHHVHSANPLSLKHSRSPLCECCGERSATLQCEEEA 265
CDFC E+ + +YC+ D+A LCL CD HVHSAN LS +HSR+ LCE C + A ++C EE
Sbjct: 5 CDFCGEQRSIVYCRSDAASLCLSCDRHVHSANALSRRHSRTLLCERCNSQPAFVRCIEEK 64

Query: 266 RFFCATCEQSAHNG----EGHTLVKASTFSGCLVPSQVASAW 379
C C+ + H G H + +SGC +++ W
Sbjct: 65 ISLCQNCDWTGHGGSTTTSSHKKETINCYSGCPSSEGLSTMW 106