BP921487
Clone id YMU001_000150_E05
Library
Length 531
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000150_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGAAGAATTCGCGCCTTGAAGTGTATTTTGAATATGTTTTTGGAACTACCACCTGAGGA
AGATCATCCCGGATAAATTCAGCAAACCGTGTCCCATTCTGCCCTTCCTTCACATAATCA
AGCTCTTCAAAAAATCGTGAAGCCCATTCATCCACAAGCCCAACAATATCTGTAGCAATC
TGTGGAAATCTGCGCAAGGCTACACCCAGCTTGCGAATAATGAACAAATCAATGGTAACT
GTTTCGAGGACAAAGGGTCGTTGAACCTTCACAGCCACCAAATCGCCATTTTCCTTCAAA
CGTCCTTTATAGACTTGCCCCAATGATGCAGCAGCAATTGGAGAACGAGAAAGCTCTGAG
TAAGACTCAGACCAGTGACTTCCCAGCTCTGCCCCTATGAGATCCATAGCCACATCATTT
GGAAACGAGGGAACCTGGGTCCACCACTGAGTTACAACCACAATTACCTCCCCTGCTTTA
CTTTAAAGCTCCCTCCCTTCCTCCCCAACTTGCACCAACCCGGGACACTGT
■■Homology search results ■■ -
sp_hit_id Q55680
Definition sp|Q55680|Y005_SYNY3 Uncharacterized protein sll0005 OS=Synechocystis sp. (strain PCC 6803)
Align length 140
Score (bit) 131.0
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921487|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_E05.
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q55680|Y005_SYNY3 Uncharacterized protein sll0005 OS=Synechoc... 131 2e-30
sp|Q94BU1|Y1181_ARATH Uncharacterized aarF domain-containing pro... 116 7e-26
sp|Q9MA15|Y1960_ARATH Uncharacterized aarF domain-containing pro... 112 1e-24
sp|P73121|Y1919_SYNY3 Uncharacterized protein slr1919 OS=Synecho... 100 3e-21
sp|Q8RWG1|Y4139_ARATH Uncharacterized aarF domain-containing pro... 97 5e-20
sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770 OS=Synecho... 80 4e-15
sp|Q55884|Y095_SYNY3 Uncharacterized protein sll0095 OS=Synechoc... 73 7e-13
sp|A7MQL5|UBIB_ENTS8 Probable ubiquinone biosynthesis protein ub... 63 7e-10
sp|P73577|Y889_SYNY3 Uncharacterized protein slr0889 OS=Synechoc... 63 9e-10
sp|Q92338|ABCI_SCHPO Protein ABC1 homolog, mitochondrial OS=Schi... 61 3e-09
sp|A4XPM5|UBIB_PSEMY Probable ubiquinone biosynthesis protein ub... 61 4e-09
sp|A6TGL5|UBIB_KLEP7 Probable ubiquinone biosynthesis protein ub... 60 5e-09
sp|A4WFY3|UBIB_ENT38 Probable ubiquinone biosynthesis protein ub... 60 6e-09
sp|A4STK9|UBIB_AERS4 Probable ubiquinone biosynthesis protein ub... 60 6e-09
sp|Q3YVD0|UBIB_SHISS Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|P0A6A2|UBIB_SHIFL Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q0SZ27|UBIB_SHIF8 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q32A13|UBIB_SHIDS Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q31UF1|UBIB_SHIBS Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q1R475|UBIB_ECOUT Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|P0A6A0|UBIB_ECOLI Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|B1IW70|UBIB_ECOLC Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q8FBI8|UBIB_ECOL6 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q0TAL9|UBIB_ECOL5 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|A1AI24|UBIB_ECOK1 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|A8A6U2|UBIB_ECOHS Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|P0A6A1|UBIB_ECO57 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|A7ZU42|UBIB_ECO24 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|A8ACY4|UBIB_CITK8 Probable ubiquinone biosynthesis protein ub... 60 8e-09
sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing pro... 60 8e-09

>sp|Q55680|Y005_SYNY3 Uncharacterized protein sll0005
OS=Synechocystis sp. (strain PCC 6803) GN=sll0005 PE=3
SV=1
Length = 681

Score = 131 bits (330), Expect = 2e-30
Identities = 71/140 (50%), Positives = 98/140 (70%), Gaps = 1/140 (0%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSFPN+VA I ELG+ E Y+ELS PIAAASLGQVYKG+LK G+ VAVKVQRP
Sbjct: 148 PSFPNEVAYRFIEEELGAPAEEIYAELSPEPIAAASLGQVYKGKLK-TGEAVAVKVQRPD 206

Query: 237 VLETVTIDLFIIRKLGV-ALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEF 61
++ +T+D++I+R L + A R ++ +D+V + DE ASR FEE++Y +E NG +FA+
Sbjct: 207 LVRRITLDIYIMRSLSLWARRSVKRLRSDLVAITDELASRVFEEMNYYQEAINGEKFAQ- 265

Query: 60 IRDDLPQVVVPKTYSKYTSR 1
+ LP++ VP Y +YT R
Sbjct: 266 LYGSLPEIYVPSIYWQYTGR 285


>sp|Q94BU1|Y1181_ARATH Uncharacterized aarF domain-containing
protein kinase At1g71810, chloroplastic OS=Arabidopsis
thaliana GN=At1g71810 PE=1 SV=1
Length = 692

Score = 116 bits (290), Expect = 7e-26
Identities = 57/136 (41%), Positives = 91/136 (66%)
Frame = -2

Query: 411 FPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPFVL 232
F +VA ++I ELG E +SE+S P+AAASLGQVY+ RL+ +G +VAVKVQRP V
Sbjct: 166 FSTEVAFNMIEDELGLPIDELFSEISPEPVAAASLGQVYQARLRRSGKVVAVKVQRPGVR 225

Query: 231 ETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFIRD 52
+ +D I+R + +++ + +D+ +VDEWA+ F+E+DY+ E QNG +F + +
Sbjct: 226 AAIALDTLILRYIAGLIKKAGRFNSDLEAVVDEWATSLFKEMDYLNEAQNGIKFRK-LYG 284

Query: 51 DLPQVVVPKTYSKYTS 4
+ V+VPK Y++Y++
Sbjct: 285 GIKDVLVPKMYTEYST 300


>sp|Q9MA15|Y1960_ARATH Uncharacterized aarF domain-containing
protein kinase At1g79600, chloroplastic OS=Arabidopsis
thaliana GN=At1g79600 PE=1 SV=1
Length = 711

Score = 112 bits (279), Expect = 1e-24
Identities = 61/140 (43%), Positives = 89/140 (63%), Gaps = 1/140 (0%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P+FP+ A I EL +S +S PIAAASLGQVYK +L+ +G +VAVKVQRP
Sbjct: 191 PTFPDAEAFACIERELDLSLETIFSSVSPEPIAAASLGQVYKAQLRYSGQVVAVKVQRPG 250

Query: 237 VLETVTIDLFIIRKLGVALRRFPQ-IATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEF 61
+ E + +D ++IR +G + ++ I TD++ L+DE+A R ++EL+YV+E QN RF +
Sbjct: 251 IEEAIGLDFYLIRGVGKLINKYVDFITTDVLTLIDEFACRVYQELNYVQEAQNARRFKKL 310

Query: 60 IRDDLPQVVVPKTYSKYTSR 1
D V+VP + YTSR
Sbjct: 311 YADK-ADVLVPDIFWDYTSR 329


>sp|P73121|Y1919_SYNY3 Uncharacterized protein slr1919
OS=Synechocystis sp. (strain PCC 6803) GN=slr1919 PE=3
SV=1
Length = 566

Score = 100 bits (250), Expect = 3e-21
Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 2/141 (1%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P F ND+A L+ +LG E+Y E+S P+AAASLGQVY+ L +G+ VAVKVQRP
Sbjct: 114 PPFDNDLAFQLMEEQLGMKVDEAYREISAHPVAAASLGQVYRAML-FSGEEVAVKVQRPN 172

Query: 237 VLETVTIDLFIIRKLGVALRRF--PQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAE 64
+ +++DL+++R RF + D+ +VDE+ + FEE+DY+ EG+N +FAE
Sbjct: 173 LRPRLSLDLYLMRLGAQKFGRFLPLNLGHDLTLIVDEFGIKLFEEIDYLNEGRNAEKFAE 232

Query: 63 FIRDDLPQVVVPKTYSKYTSR 1
D +V VP Y +Y+++
Sbjct: 233 NFHGD-AEVKVPCIYWQYSNQ 252


>sp|Q8RWG1|Y4139_ARATH Uncharacterized aarF domain-containing
protein kinase At4g31390, chloroplastic OS=Arabidopsis
thaliana GN=At4g31390 PE=1 SV=1
Length = 682

Score = 97.1 bits (240), Expect = 5e-20
Identities = 56/135 (41%), Positives = 78/135 (57%), Gaps = 2/135 (1%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P FPN+VA ++I ELG +S++S IAAASLGQVY+ L+ G+ VA+KVQRP
Sbjct: 211 PPFPNEVAFNIIEEELGQPLENIFSKISSQTIAAASLGQVYRATLRATGEDVAIKVQRPQ 270

Query: 237 VLETVTIDLFIIRKLGVALRRF--PQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAE 64
+ + DLF+ R L L F ++ + +VDE+ + EELDY E +N F E
Sbjct: 271 IEPIIYRDLFLFRTLASFLNGFSLQKLGCNAELIVDEFGEKLLEELDYTLEARNIEDFLE 330

Query: 63 FIRDDLPQVVVPKTY 19
+DD P V +P Y
Sbjct: 331 NFKDD-PTVKIPGVY 344


>sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770
OS=Synechocystis sp. (strain PCC 6803) GN=sll1770 PE=3
SV=1
Length = 585

Score = 80.5 bits (197), Expect = 4e-15
Identities = 51/140 (36%), Positives = 78/140 (55%), Gaps = 2/140 (1%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P+F + A +I ELG ++ Y P+AAASLGQV+K +L G+ V VKVQRP
Sbjct: 129 PAFSYEQAAGIIEEELGKPIAKLYRSFDPVPLAAASLGQVHKAQL-HTGEDVVVKVQRPG 187

Query: 237 VLETVTIDLFIIRKLGVALRRFPQ--IATDIVGLVDEWASRFFEELDYVKEGQNGTRFAE 64
+ + TIDL I++K+ + P+ D G+ +E ++E DY++EG++ F
Sbjct: 188 LKKLFTIDLAILKKIAQYFQNHPKWGRGRDWNGIYEECCKILWQETDYLREGRSADTFRR 247

Query: 63 FIRDDLPQVVVPKTYSKYTS 4
R + V VP+ Y +YTS
Sbjct: 248 NFRGE-DWVKVPRVYWRYTS 266


>sp|Q55884|Y095_SYNY3 Uncharacterized protein sll0095
OS=Synechocystis sp. (strain PCC 6803) GN=sll0095 PE=3
SV=1
Length = 567

Score = 73.2 bits (178), Expect = 7e-13
Identities = 50/145 (34%), Positives = 79/145 (54%), Gaps = 6/145 (4%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P F + A+ +I EL E + + +P+A+ASLGQV++ L G+ V VKVQRP
Sbjct: 102 PPFDSRQAIAVIEQELHGAIDEIFQQFEVTPLASASLGQVHRAVL-PTGEAVVVKVQRPG 160

Query: 237 VLETVTIDLFIIRK-LGVALRRFPQIAT-----DIVGLVDEWASRFFEELDYVKEGQNGT 76
+ + +D ++ + L +A R P +I + E+ S F E+DY+ EG+N
Sbjct: 161 LDSLLNLDFELLHQTLRLAKRWLPGFRRLAQKYEIEAIYQEFFSLLFLEIDYIHEGKNAE 220

Query: 75 RFAEFIRDDLPQVVVPKTYSKYTSR 1
RF + D P+V VP+ Y +YT+R
Sbjct: 221 RFRQNFA-DYPRVRVPEIYWQYTTR 244


>sp|A7MQL5|UBIB_ENTS8 Probable ubiquinone biosynthesis protein ubiB
OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=ubiB
PE=3 SV=1
Length = 546

Score = 63.2 bits (152), Expect = 7e-10
Identities = 39/122 (31%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
Frame = -2

Query: 354 ESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPFVLETVTIDLFIIRKLGVALRR 175
E + + +P+A+AS+ QV+ RLKENG V +KV RP +L + D+ +I +L R
Sbjct: 120 EWFDDFDITPLASASIAQVHTARLKENGKEVVIKVIRPDILPVIKADMKLIYRLA---RW 176

Query: 174 FPQIATD-----IVGLVDEWASRFFEELDYVKEGQNGTRFAEFIRDDLPQVVVPKTYSKY 10
P++ D + +V E+ +ELD ++E N + ++ P + VP+ YS Y
Sbjct: 177 VPRLLPDGRRLRPMEVVREYEKTLLDELDLLREAANAIQLRRNF-ENSPMLYVPEVYSDY 235

Query: 9 TS 4
S
Sbjct: 236 CS 237


>sp|P73577|Y889_SYNY3 Uncharacterized protein slr0889
OS=Synechocystis sp. (strain PCC 6803) GN=slr0889 PE=3
SV=1
Length = 408

Score = 62.8 bits (151), Expect = 9e-10
Identities = 47/145 (32%), Positives = 74/145 (51%), Gaps = 6/145 (4%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
P P DL+ E E++ E+ PIAA S+GQ+++ L ++G+ VA+KV+RP
Sbjct: 87 PPLPWSAIEDLLQREFPQPLGETFQEIESEPIAAGSIGQIHRAVL-QSGETVAIKVKRPG 145

Query: 237 VLETVTIDLFIIRKLG--VALRRFPQIATDIVGLVDEWASRFFEELDYVKE----GQNGT 76
+ V D +I+ + +AL F Q DIV L DE+ EL++ E T
Sbjct: 146 IDVIVEQDSLLIKDVAELLALTEFGQ-NYDIVKLADEFTQTVKAELNFDTEAAYTNNLRT 204

Query: 75 RFAEFIRDDLPQVVVPKTYSKYTSR 1
A+ D Q+V+PK Y + T++
Sbjct: 205 NLAKTTWFDPNQLVIPKVYWELTNQ 229


>sp|Q92338|ABCI_SCHPO Protein ABC1 homolog, mitochondrial
OS=Schizosaccharomyces pombe GN=abc1 PE=2 SV=1
Length = 610

Score = 61.2 bits (147), Expect = 3e-09
Identities = 40/122 (32%), Positives = 58/122 (47%)
Frame = -2

Query: 414 SFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPFV 235
S P ++ LG +W YSE R P+AAAS+GQV++ RL N V VKVQ P V
Sbjct: 272 SMPEKQLEQVMVKNLGKNWMTHYSEFDRKPMAAASIGQVHRARLASNHMEVVVKVQYPGV 331

Query: 234 LETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFIR 55
+ ++ DL + L A R P+ + + E DY +E RF ++
Sbjct: 332 MSSIDSDLNNLAYLLKASRILPK-GLFLENSLAAARKELKWECDYEREAAFAERFGSLLK 390

Query: 54 DD 49
+D
Sbjct: 391 ND 392


tr_hit_id Q9LRN0
Definition tr|Q9LRN0|Q9LRN0_ARATH Genomic DNA, chromosome 3, P1 clone:MUJ8 (AT3g24190/MUJ8_17) OS=Arabidopsis thaliana
Align length 139
Score (bit) 224.0
E-value 2.0e-57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921487|Adiantum capillus-veneris mRNA, clone:
YMU001_000150_E05.
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9LRN0|Q9LRN0_ARATH Genomic DNA, chromosome 3, P1 clone:MUJ8 ... 224 2e-57
tr|Q6K6A6|Q6K6A6_ORYSJ ABC1-like (Putative uncharacterized prote... 221 1e-56
tr|A2XB08|A2XB08_ORYSI Putative uncharacterized protein OS=Oryza... 221 1e-56
tr|A9TUS6|A9TUS6_PHYPA Predicted protein OS=Physcomitrella paten... 221 2e-56
tr|A9RTC8|A9RTC8_PHYPA Predicted protein OS=Physcomitrella paten... 217 3e-55
tr|Q018B2|Q018B2_OSTTA Predicted unusual protein kinase (ISS) OS... 190 3e-47
tr|A4RY77|A4RY77_OSTLU Predicted protein OS=Ostreococcus lucimar... 187 2e-46
tr|B8AEU6|B8AEU6_ORYSI Putative uncharacterized protein OS=Oryza... 182 7e-45
tr|A8J9R1|A8J9R1_CHLRE ABC1/COQ8 ser/thr kinase OS=Chlamydomonas... 178 1e-43
tr|A7QTH8|A7QTH8_VITVI Chromosome undetermined scaffold_168, who... 151 2e-35
tr|A9SFI7|A9SFI7_PHYPA Predicted protein OS=Physcomitrella paten... 142 1e-32
tr|B7KHW6|B7KHW6_9CHRO ABC-1 domain protein OS=Cyanothece sp. PC... 138 1e-31
tr|B8HPK6|B8HPK6_9CHRO ABC-1 domain protein OS=Cyanothece sp. PC... 136 5e-31
tr|B1WZ00|B1WZ00_CYAA5 Putative uncharacterized protein OS=Cyano... 135 9e-31
tr|A9T5N0|A9T5N0_PHYPA Predicted protein OS=Physcomitrella paten... 135 9e-31
tr|B5Y3Z3|B5Y3Z3_PHATR Predicted protein OS=Phaeodactylum tricor... 135 2e-30
tr|A3IK12|A3IK12_9CHRO ABC1-like protein OS=Cyanothece sp. CCY 0... 134 2e-30
tr|B7JU93|B7JU93_SYNP8 ABC-1 domain protein OS=Synechococcus sp.... 134 4e-30
tr|B4BXC2|B4BXC2_9CHRO ABC-1 domain protein OS=Cyanothece sp. PC... 134 4e-30
tr|B5YMB6|B5YMB6_THAPS Putative uncharacterized protein OS=Thala... 134 4e-30
tr|B4B085|B4B085_9CHRO ABC-1 domain protein OS=Cyanothece sp. PC... 132 8e-30
tr|Q4C3T1|Q4C3T1_CROWT ABC-1 OS=Crocosphaera watsonii GN=CwatDRA... 131 2e-29
tr|Q8DKA9|Q8DKA9_THEEB Tll0950 protein OS=Thermosynechococcus el... 131 2e-29
tr|B2IXX4|B2IXX4_NOSP7 ABC-1 domain protein OS=Nostoc punctiform... 130 3e-29
tr|Q3MAY3|Q3MAY3_ANAVT ABC-1 OS=Anabaena variabilis (strain ATCC... 130 5e-29
tr|B0JVW3|B0JVW3_MICAN Putative uncharacterized protein OS=Micro... 130 5e-29
tr|A0ZMK1|A0ZMK1_NODSP ABC-1 (Fragment) OS=Nodularia spumigena C... 130 5e-29
tr|A9TBH8|A9TBH8_PHYPA Predicted protein OS=Physcomitrella paten... 130 5e-29
tr|Q8YMH3|Q8YMH3_ANASP All4960 protein OS=Anabaena sp. (strain P... 129 7e-29
tr|Q10ZC0|Q10ZC0_TRIEI ABC-1 OS=Trichodesmium erythraeum (strain... 127 3e-28

>tr|Q9LRN0|Q9LRN0_ARATH Genomic DNA, chromosome 3, P1 clone:MUJ8
(AT3g24190/MUJ8_17) OS=Arabidopsis thaliana GN=At3g24190
PE=2 SV=1
Length = 793

Score = 224 bits (572), Expect = 2e-57
Identities = 109/139 (78%), Positives = 123/139 (88%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PS+P+DVAM LI ELG W + YSELS SPIAAASLGQVYKGRLKENGDLVAVKVQRPF
Sbjct: 236 PSYPDDVAMALIEEELGKPWYDVYSELSPSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 295

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVT+DLF+IR LG+ LR+FPQ++ D+VGLVDEWA+RFFEELDYV EG+NGT FAE +
Sbjct: 296 VLETVTVDLFVIRNLGLFLRKFPQVSVDVVGLVDEWAARFFEELDYVNEGENGTYFAEMM 355

Query: 57 RDDLPQVVVPKTYSKYTSR 1
+ DLPQVVVPKTY KYTSR
Sbjct: 356 KKDLPQVVVPKTYQKYTSR 374


>tr|Q6K6A6|Q6K6A6_ORYSJ ABC1-like (Putative uncharacterized protein)
OS=Oryza sativa subsp. japonica GN=P0643F09.20 PE=4 SV=1
Length = 784

Score = 221 bits (564), Expect = 1e-56
Identities = 109/139 (78%), Positives = 121/139 (87%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSF +D+AM L+ ELG W E YSELS SPIAAASLGQVYKGRLKE G+LVAVKVQRPF
Sbjct: 232 PSFSDDLAMTLLEEELGRPWHEIYSELSPSPIAAASLGQVYKGRLKETGELVAVKVQRPF 291

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVTIDLFIIR LG+ LRRFPQ++ D+VGLVDEWA+RFFEELDYV EG+NG RFAE +
Sbjct: 292 VLETVTIDLFIIRNLGLVLRRFPQVSIDVVGLVDEWAARFFEELDYVNEGENGNRFAEMM 351

Query: 57 RDDLPQVVVPKTYSKYTSR 1
+ DLPQVVVPKTY KYTSR
Sbjct: 352 KKDLPQVVVPKTYQKYTSR 370


>tr|A2XB08|A2XB08_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09441 PE=4 SV=1
Length = 784

Score = 221 bits (564), Expect = 1e-56
Identities = 109/139 (78%), Positives = 121/139 (87%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSF +D+AM L+ ELG W E YSELS SPIAAASLGQVYKGRLKE G+LVAVKVQRPF
Sbjct: 232 PSFSDDLAMTLLEEELGRPWHEIYSELSPSPIAAASLGQVYKGRLKETGELVAVKVQRPF 291

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVTIDLFIIR LG+ LRRFPQ++ D+VGLVDEWA+RFFEELDYV EG+NG RFAE +
Sbjct: 292 VLETVTIDLFIIRNLGLVLRRFPQVSIDVVGLVDEWAARFFEELDYVNEGENGNRFAEMM 351

Query: 57 RDDLPQVVVPKTYSKYTSR 1
+ DLPQVVVPKTY KYTSR
Sbjct: 352 KKDLPQVVVPKTYQKYTSR 370


>tr|A9TUS6|A9TUS6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_198486 PE=4 SV=1
Length = 709

Score = 221 bits (562), Expect = 2e-56
Identities = 107/139 (76%), Positives = 125/139 (89%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSFPND+AM LI +ELG+ W E YSEL+ SPIAAASLGQVYKG+L E G+ VAVKVQRP+
Sbjct: 153 PSFPNDIAMALIESELGNPWQEIYSELTESPIAAASLGQVYKGKLIETGETVAVKVQRPY 212

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVTIDLFIIR+LGV+LRRFPQ +TD+VGLVDEWA+RFFEELDY+ EG+N TRFAE +
Sbjct: 213 VLETVTIDLFIIRRLGVSLRRFPQASTDVVGLVDEWAARFFEELDYINEGENATRFAEQM 272

Query: 57 RDDLPQVVVPKTYSKYTSR 1
R DLPQVVVPKT++K+TSR
Sbjct: 273 RVDLPQVVVPKTFTKFTSR 291


>tr|A9RTC8|A9RTC8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160867 PE=4 SV=1
Length = 827

Score = 217 bits (552), Expect = 3e-55
Identities = 113/158 (71%), Positives = 126/158 (79%), Gaps = 19/158 (12%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSFPNDVAM LI +ELG W E YSEL+ SPIAAASLGQVYKG+L E G+ VAVKVQRP+
Sbjct: 252 PSFPNDVAMALIESELGKPWQEVYSELTESPIAAASLGQVYKGKLLETGETVAVKVQRPY 311

Query: 237 VLETVTIDLFIIRKLGVALRRFPQ-------------------IATDIVGLVDEWASRFF 115
VLETVTIDLFIIR+LGVALRRFPQ IATDIVGLVDEWA+RFF
Sbjct: 312 VLETVTIDLFIIRRLGVALRRFPQACDLWSSYLLACSSCILETIATDIVGLVDEWAARFF 371

Query: 114 EELDYVKEGQNGTRFAEFIRDDLPQVVVPKTYSKYTSR 1
EELDY+ EG+NGTRFAE ++ DLPQVVVPKT++KYTSR
Sbjct: 372 EELDYINEGENGTRFAEQMKVDLPQVVVPKTFTKYTSR 409


>tr|Q018B2|Q018B2_OSTTA Predicted unusual protein kinase (ISS)
OS=Ostreococcus tauri GN=Ot05g05080 PE=4 SV=1
Length = 780

Score = 190 bits (483), Expect = 3e-47
Identities = 92/139 (66%), Positives = 112/139 (80%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSF N +A + ELG W E YSEL P+AAASLGQVYKG+LK+ G++VAVKVQRP
Sbjct: 225 PSFDNGLAFATLETELGCKWQEVYSELGPDPVAAASLGQVYKGKLKDTGEVVAVKVQRPA 284

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETV+IDLF++RK+GV LRRFP I TD+VGL+DEWA+RFFEELDY EG+N T FA+ I
Sbjct: 285 VLETVSIDLFVLRKVGVFLRRFPAITTDVVGLLDEWAARFFEELDYNLEGENQTNFAKSI 344

Query: 57 RDDLPQVVVPKTYSKYTSR 1
DLPQVVVP+TY+++T R
Sbjct: 345 AKDLPQVVVPRTYAQFTRR 363


>tr|A4RY77|A4RY77_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_49684 PE=4 SV=1
Length = 788

Score = 187 bits (476), Expect = 2e-46
Identities = 90/139 (64%), Positives = 111/139 (79%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSF N +A + ELG W + Y+EL P+AAASLGQVYKG LKE GD+VAVKVQRP
Sbjct: 261 PSFDNGLAFATLEDELGCKWQDVYTELGPEPVAAASLGQVYKGVLKETGDIVAVKVQRPA 320

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETV++DL+++RK+G+ L+RFP I TD+VGL+DEWA+RFFEELDY EG+N T+FA I
Sbjct: 321 VLETVSVDLYVLRKIGMFLKRFPAITTDVVGLLDEWAARFFEELDYNLEGENQTKFAASI 380

Query: 57 RDDLPQVVVPKTYSKYTSR 1
DLPQVVVPKT++KYT R
Sbjct: 381 AKDLPQVVVPKTFAKYTRR 399


>tr|B8AEU6|B8AEU6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09446 PE=4 SV=1
Length = 417

Score = 182 bits (463), Expect = 7e-45
Identities = 88/106 (83%), Positives = 97/106 (91%)
Frame = -2

Query: 318 AASLGQVYKGRLKENGDLVAVKVQRPFVLETVTIDLFIIRKLGVALRRFPQIATDIVGLV 139
AASLGQVYKGRLKE G+LVAVKVQRPFVLETVTIDLFIIR LG+ LRRFPQ++ D+VGLV
Sbjct: 7 AASLGQVYKGRLKETGELVAVKVQRPFVLETVTIDLFIIRNLGLVLRRFPQVSIDVVGLV 66

Query: 138 DEWASRFFEELDYVKEGQNGTRFAEFIRDDLPQVVVPKTYSKYTSR 1
DEWA+RFFEELDYV EG+NG RFAE ++ DLPQVVVPKTY KYTSR
Sbjct: 67 DEWAARFFEELDYVNEGENGNRFAEMMKKDLPQVVVPKTYQKYTSR 112


>tr|A8J9R1|A8J9R1_CHLRE ABC1/COQ8 ser/thr kinase OS=Chlamydomonas
reinhardtii GN=AKC3 PE=4 SV=1
Length = 860

Score = 178 bits (452), Expect = 1e-43
Identities = 89/130 (68%), Positives = 107/130 (82%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSF + +AM +I ELG+ W E ++EL+ PIAAASLGQVYKGRLK G+ VAVKVQRP+
Sbjct: 208 PSFDSKLAMQVINEELGAPWYEVFAELTPEPIAAASLGQVYKGRLK-TGETVAVKVQRPY 266

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVTIDL+IIR+LG+ LRRFPQ+ TD+V L+DEWA+RFFEELDYV EG N RFAE +
Sbjct: 267 VLETVTIDLYIIRRLGIFLRRFPQLTTDVVALLDEWAARFFEELDYVHEGANSERFAEQM 326

Query: 57 RDDLPQVVVP 28
R DLPQ+ VP
Sbjct: 327 RVDLPQLAVP 336


>tr|A7QTH8|A7QTH8_VITVI Chromosome undetermined scaffold_168, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006334001 PE=4 SV=1
Length = 798

Score = 151 bits (382), Expect = 2e-35
Identities = 89/148 (60%), Positives = 103/148 (69%), Gaps = 9/148 (6%)
Frame = -2

Query: 417 PSFPNDVAMDLIGAELGSHWSESYSELSRSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 238
PSFP+DVAM LI ELG W + YSEL+ SPIAAASLGQVYKGRLKENGDLVAVKVQRPF
Sbjct: 243 PSFPDDVAMALIEEELGRPWHKIYSELTSSPIAAASLGQVYKGRLKENGDLVAVKVQRPF 302

Query: 237 VLETVTIDLFIIRKLGVALRRFPQIATDIVGLVDEWASRFFEELDYVKEGQNGTRFAEFI 58
VLETVT+DLF+IR LG+ LR+FPQ ++V LD +K G G++ +E
Sbjct: 303 VLETVTVDLFVIRNLGLVLRKFPQAKMNVVTT---------SMLDNLK-GVCGSQQSEQR 352

Query: 57 RDD---------LPQVVVPKTYSKYTSR 1
R D + QVVVPKTY KYTSR
Sbjct: 353 RGDSSFGKPIITVYQVVVPKTYEKYTSR 380