BP921529
Clone id YMU001_000151_A10
Library
Length 433
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000151_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTGAACACAAATAAACTTACACCAAGTTCTGCAAAAGCTATTTTGTACACTGCTCT
TTTGTTCTGGGATGTCCCATCAACATATACTCTTACCATTCCTTTTTCAGTAGGATTCTG
CCCACATAGCCTCCGGAGGGCCTTTTAACTATAAAGTCTCAGCTACTCTCCTGAAGTGTT
TTCCAAAATGCTTGAGGCACAAACAAGGGATGGTATCTACAGGCCTTTTCGCCATTAAAA
TCTGTATTTCTAAGTGGCCACCACTACCGCCGTATTATTCTCGGTCAGCATTTGCCCATG
GCTATGATCACCATCATAAGTTACAATCAGCATATTGGAGTCGTCCACATCCCGTTCCAC
ATGTTTCTTAGCTGGACAACCTCGCACACTGCTGCATCTATAGTAGCCCCTAGGATGAGG
CGAGCCCTTTATG
■■Homology search results ■■ -
sp_hit_id Q32SG4
Definition sp|Q32SG4|WRKY1_MAIZE Protein WRKY1 OS=Zea mays
Align length 51
Score (bit) 93.2
E-value 4.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921529|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_A10.
(433 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q32SG4|WRKY1_MAIZE Protein WRKY1 OS=Zea mays PE=1 SV=1 93 4e-19
sp|O22176|WRK15_ARATH Probable WRKY transcription factor 15 OS=A... 91 2e-18
sp|Q9SR07|WRK39_ARATH Probable WRKY transcription factor 39 OS=A... 91 3e-18
sp|Q9STX0|WRKY7_ARATH Probable WRKY transcription factor 7 OS=Ar... 90 3e-18
sp|Q93WU6|WRK74_ARATH Probable WRKY transcription factor 74 OS=A... 89 6e-18
sp|Q9SJA8|WRK17_ARATH Probable WRKY transcription factor 17 OS=A... 87 3e-17
sp|Q9SV15|WRK11_ARATH Probable WRKY transcription factor 11 OS=A... 87 4e-17
sp|O04336|WRK21_ARATH Probable WRKY transcription factor 21 OS=A... 79 6e-15
sp|Q9LP56|WRK65_ARATH Probable WRKY transcription factor 65 OS=A... 76 7e-14
sp|Q9SI37|WRKY1_ARATH WRKY transcription factor 1 OS=Arabidopsis... 72 1e-12
sp|O64747|WRK35_ARATH Probable WRKY transcription factor 35 OS=A... 71 2e-12
sp|Q9SA80|WRK14_ARATH Probable WRKY transcription factor 14 OS=A... 71 2e-12
sp|Q93WV5|WRK69_ARATH Probable WRKY transcription factor 69 OS=A... 69 8e-12
sp|Q8VWQ5|WRK50_ARATH Probable WRKY transcription factor 50 OS=A... 69 1e-11
sp|Q9FLX8|WRK27_ARATH Probable WRKY transcription factor 27 OS=A... 69 1e-11
sp|O04609|WRK22_ARATH WRKY transcription factor 22 OS=Arabidopsi... 68 2e-11
sp|Q9LXG8|WRK72_ARATH Probable WRKY transcription factor 72 OS=A... 64 4e-10
sp|P59583|WRK32_ARATH Probable WRKY transcription factor 32 OS=A... 63 6e-10
sp|Q9C519|WRKY6_ARATH WRKY transcription factor 6 OS=Arabidopsis... 61 2e-09
sp|Q93WU7|WRK58_ARATH Probable WRKY transcription factor 58 OS=A... 61 2e-09
sp|Q93WT0|WRK31_ARATH Probable WRKY transcription factor 31 OS=A... 61 2e-09
sp|Q9SUS1|WRK29_ARATH Probable WRKY transcription factor 29 OS=A... 60 3e-09
sp|Q9C9F0|WRKY9_ARATH Probable WRKY transcription factor 9 OS=Ar... 60 4e-09
sp|Q9XEC3|WRK42_ARATH Probable WRKY transcription factor 42 OS=A... 60 4e-09
sp|Q8S8P5|WRK33_ARATH Probable WRKY transcription factor 33 OS=A... 60 4e-09
sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=A... 60 5e-09
sp|Q9FGZ4|WRK48_ARATH Probable WRKY transcription factor 48 OS=A... 59 7e-09
sp|Q9ZSI7|WRK47_ARATH Probable WRKY transcription factor 47 OS=A... 59 7e-09
sp|Q93WV0|WRK20_ARATH Probable WRKY transcription factor 20 OS=A... 57 3e-08
sp|Q8VWV6|WRK61_ARATH Probable WRKY transcription factor 61 OS=A... 57 3e-08

>sp|Q32SG4|WRKY1_MAIZE Protein WRKY1 OS=Zea mays PE=1 SV=1
Length = 397

Score = 93.2 bits (230), Expect = 4e-19
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTE 280
IKGSPHPRGYY+CSSVRGCPA+KHVER VDD +MLIVTY+GDH+H ++L +
Sbjct: 345 IKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLAQ 395


>sp|O22176|WRK15_ARATH Probable WRKY transcription factor 15
OS=Arabidopsis thaliana GN=WRKY15 PE=2 SV=1
Length = 317

Score = 90.9 bits (224), Expect = 2e-18
Identities = 38/45 (84%), Positives = 43/45 (95%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSH 298
IKGSPHPRGYY+CSSVRGCPA+KHVER DDS+MLIVTY+GDH+H
Sbjct: 253 IKGSPHPRGYYKCSSVRGCPARKHVERAADDSSMLIVTYEGDHNH 297


>sp|Q9SR07|WRK39_ARATH Probable WRKY transcription factor 39
OS=Arabidopsis thaliana GN=WRKY39 PE=2 SV=1
Length = 330

Score = 90.5 bits (223), Expect = 3e-18
Identities = 36/53 (67%), Positives = 49/53 (92%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENN 274
IKGSPHPRGYY+CSSVRGCPA+KHVER +D+++MLIVTY+G+H+H ++L+ +
Sbjct: 275 IKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNHSRILSSQS 327


>sp|Q9STX0|WRKY7_ARATH Probable WRKY transcription factor 7
OS=Arabidopsis thaliana GN=WRKY7 PE=2 SV=1
Length = 353

Score = 90.1 bits (222), Expect = 3e-18
Identities = 38/49 (77%), Positives = 45/49 (91%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQML 286
IKGSPHPRGYY+CSSVRGCPA+KHVER +DD+ MLIVTY+GDH+H +L
Sbjct: 294 IKGSPHPRGYYKCSSVRGCPARKHVERALDDAMMLIVTYEGDHNHALVL 342


>sp|Q93WU6|WRK74_ARATH Probable WRKY transcription factor 74
OS=Arabidopsis thaliana GN=WRKY74 PE=2 SV=1
Length = 330

Score = 89.4 bits (220), Expect = 6e-18
Identities = 36/53 (67%), Positives = 49/53 (92%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENN 274
IKGSPHPRGYY+CSSVRGCPA+KHVER V++++MLIVTY+G+H+H ++L+ +
Sbjct: 275 IKGSPHPRGYYKCSSVRGCPARKHVERCVEETSMLIVTYEGEHNHSRILSSQS 327


>sp|Q9SJA8|WRK17_ARATH Probable WRKY transcription factor 17
OS=Arabidopsis thaliana GN=WRKY17 PE=2 SV=2
Length = 321

Score = 87.0 bits (214), Expect = 3e-17
Identities = 37/59 (62%), Positives = 46/59 (77%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVVVA 256
IKGSPHPRGYY+CS+ RGCPA+KHVER +DDS MLIVTY+G+H H Q + + V+
Sbjct: 256 IKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRHHQSTMQEHVTPSVS 314


>sp|Q9SV15|WRK11_ARATH Probable WRKY transcription factor 11
OS=Arabidopsis thaliana GN=WRKY11 PE=2 SV=2
Length = 325

Score = 86.7 bits (213), Expect = 4e-17
Identities = 36/53 (67%), Positives = 43/53 (81%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENN 274
IKGSPHPRGYY+CS+ RGCPA+KHVER +DD MLIVTY+G+H H Q + N
Sbjct: 259 IKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQSAMQEN 311


>sp|O04336|WRK21_ARATH Probable WRKY transcription factor 21
OS=Arabidopsis thaliana GN=WRKY21 PE=1 SV=1
Length = 380

Score = 79.3 bits (194), Expect = 6e-15
Identities = 32/48 (66%), Positives = 43/48 (89%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQM 289
IKGSP+PRGYY+CSS+RGCPA+KHVER ++D MLIVTY+ +H+H ++
Sbjct: 326 IKGSPYPRGYYKCSSMRGCPARKHVERCLEDPAMLIVTYEAEHNHPKL 373


>sp|Q9LP56|WRK65_ARATH Probable WRKY transcription factor 65
OS=Arabidopsis thaliana GN=WRKY65 PE=2 SV=1
Length = 259

Score = 75.9 bits (185), Expect = 7e-14
Identities = 31/52 (59%), Positives = 40/52 (76%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTEN 277
IKGSP+PRGYYRCSS +GCPA+K VER DD M+++TY +H+H LT +
Sbjct: 87 IKGSPYPRGYYRCSSTKGCPARKQVERSRDDPTMILITYTSEHNHPWPLTSS 138


>sp|Q9SI37|WRKY1_ARATH WRKY transcription factor 1 OS=Arabidopsis
thaliana GN=WRKY1 PE=1 SV=1
Length = 487

Score = 72.0 bits (175), Expect = 1e-12
Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 4/57 (7%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSH----GQMLTENN 274
+KGSP+PR YYRCSS GCP KKHVER D+ +LI TY+G H H G+++T NN
Sbjct: 320 VKGSPYPRSYYRCSSP-GCPVKKHVERSSHDTKLLITTYEGKHDHDMPPGRVVTHNN 375



Score = 34.7 bits (78), Expect = 0.17
Identities = 18/49 (36%), Positives = 26/49 (53%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQML 286
+KG+ R YYRC+ C AKK +ER ++ Y G+H H + L
Sbjct: 124 VKGNEFVRSYYRCTH-PNCKAKKQLERSA-GGQVVDTVYFGEHDHPKPL 170


tr_hit_id Q40828
Definition tr|Q40828|Q40828_PETCR WRKY3 OS=Petroselinum crispum
Align length 59
Score (bit) 94.0
E-value 3.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921529|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_A10.
(433 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q40828|Q40828_PETCR WRKY3 OS=Petroselinum crispum PE=2 SV=1 94 3e-18
tr|Q9FXS1|Q9FXS1_TOBAC WRKY transcription factor NtEIG-D48 OS=Ni... 94 4e-18
tr|A7NU09|A7NU09_VITVI Chromosome chr18 scaffold_1, whole genome... 94 4e-18
tr|A5B6Y1|A5B6Y1_VITVI Putative uncharacterized protein OS=Vitis... 94 4e-18
tr|B6TTZ9|B6TTZ9_MAIZE WRKY transcription factor 21 OS=Zea mays ... 93 6e-18
tr|B6STV8|B6STV8_MAIZE WRKY transcription factor 21 OS=Zea mays ... 93 6e-18
tr|Q6YNB9|Q6YNB9_PHYPA WRKY transcription factor 1 OS=Physcomitr... 93 8e-18
tr|B6SKM6|B6SKM6_MAIZE WRKY transcription factor 21 OS=Zea mays ... 93 8e-18
tr|A9S4W9|A9S4W9_PHYPA Transcription factor WRKY1 OS=Physcomitre... 93 8e-18
tr|Q75KW2|Q75KW2_ORYSJ Os03g0741400 protein OS=Oryza sativa subs... 92 1e-17
tr|B8AJT7|B8AJT7_ORYSI Putative uncharacterized protein OS=Oryza... 92 1e-17
tr|B3GAU6|B3GAU6_WHEAT WRKY16 transcription factor OS=Triticum a... 92 1e-17
tr|A7UGC9|A7UGC9_SOLTU WRKY transcription factor 2 OS=Solanum tu... 92 2e-17
tr|B4FD07|B4FD07_MAIZE Putative uncharacterized protein OS=Zea m... 91 4e-17
tr|B4F9J0|B4F9J0_MAIZE Putative uncharacterized protein OS=Zea m... 91 4e-17
tr|A9PII7|A9PII7_POPTR Putative uncharacterized protein OS=Popul... 91 4e-17
tr|B4FJE7|B4FJE7_MAIZE Putative uncharacterized protein OS=Zea m... 90 5e-17
tr|Q2QMN4|Q2QMN4_ORYSJ Os12g0597700 protein OS=Oryza sativa subs... 90 6e-17
tr|B8BMU3|B8BMU3_ORYSI Putative uncharacterized protein OS=Oryza... 90 6e-17
tr|Q9FNV1|Q9FNV1_DACGL Somatic embryogenesis related protein OS=... 89 8e-17
tr|B2KJ52|B2KJ52_HORVD WRKY transcription factor 9 (Fragment) OS... 89 8e-17
tr|B2KJ51|B2KJ51_HORVD WRKY transcription factor 8 (Fragment) OS... 89 1e-16
tr|Q09I56|Q09I56_PHYPA WRKY transcription factor 8 (Fragment) OS... 89 1e-16
tr|Q09I55|Q09I55_PHYPA WRKY transcription factor 9 (Fragment) OS... 89 1e-16
tr|A9T4I7|A9T4I7_PHYPA Transcription factor WRKY9 OS=Physcomitre... 89 1e-16
tr|A9RFR5|A9RFR5_PHYPA Transcription factor WRKY 2 OS=Physcomitr... 89 1e-16
tr|A7PLF6|A7PLF6_VITVI Chromosome chr7 scaffold_20, whole genome... 89 1e-16
tr|Q09I57|Q09I57_PHYPA WRKY transcription factor 7 (Fragment) OS... 88 2e-16
tr|B7FGQ3|B7FGQ3_MEDTR Putative uncharacterized protein OS=Medic... 88 2e-16
tr|A9SCG7|A9SCG7_PHYPA Transcription factor WRKY7 OS=Physcomitre... 88 2e-16

>tr|Q40828|Q40828_PETCR WRKY3 OS=Petroselinum crispum PE=2 SV=1
Length = 341

Score = 94.0 bits (232), Expect = 3e-18
Identities = 42/59 (71%), Positives = 50/59 (84%), Gaps = 1/59 (1%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTEN-NTAVVV 259
IKGSPHPRGYY+CSSVRGCPA+KHVER VDD MLIVTY+G+H+H Q EN NT+ ++
Sbjct: 275 IKGSPHPRGYYKCSSVRGCPARKHVERAVDDPTMLIVTYEGEHNHSQSSNENTNTSHIL 333


>tr|Q9FXS1|Q9FXS1_TOBAC WRKY transcription factor NtEIG-D48
OS=Nicotiana tabacum GN=NtEIG-D48 PE=2 SV=1
Length = 350

Score = 93.6 bits (231), Expect = 4e-18
Identities = 40/58 (68%), Positives = 49/58 (84%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVVV 259
IKGSPHPRGYY+CSSVRGCPA+KHVER +DD MLIVTY+G+H+H +TE+ A V+
Sbjct: 290 IKGSPHPRGYYKCSSVRGCPARKHVERALDDPTMLIVTYEGEHNHSHSITESPAAHVL 347


>tr|A7NU09|A7NU09_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014872001
PE=4 SV=1
Length = 347

Score = 93.6 bits (231), Expect = 4e-18
Identities = 39/58 (67%), Positives = 49/58 (84%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVVV 259
IKGSPHPRGYY+CSSVRGCPA+KHVER +DD +L VTY+GDH+H Q +T+ A+V+
Sbjct: 287 IKGSPHPRGYYKCSSVRGCPARKHVERALDDPTVLTVTYEGDHNHSQSITDATAALVL 344


>tr|A5B6Y1|A5B6Y1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001145 PE=4 SV=1
Length = 116

Score = 93.6 bits (231), Expect = 4e-18
Identities = 39/58 (67%), Positives = 49/58 (84%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVVV 259
IKGSPHPRGYY+CSSVRGCPA+KHVER +DD +L VTY+GDH+H Q +T+ A+V+
Sbjct: 56 IKGSPHPRGYYKCSSVRGCPARKHVERALDDPTVLXVTYEGDHNHSQSITDATAALVL 113


>tr|B6TTZ9|B6TTZ9_MAIZE WRKY transcription factor 21 OS=Zea mays
PE=2 SV=1
Length = 392

Score = 93.2 bits (230), Expect = 6e-18
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTE 280
IKGSPHPRGYY+CSSVRGCPA+KHVER VDD +MLIVTY+GDH+H ++L +
Sbjct: 340 IKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHSRVLAQ 390


>tr|B6STV8|B6STV8_MAIZE WRKY transcription factor 21 OS=Zea mays
PE=2 SV=1
Length = 397

Score = 93.2 bits (230), Expect = 6e-18
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTE 280
IKGSPHPRGYY+CSSVRGCPA+KHVER VDD +MLIVTY+GDH+H ++L +
Sbjct: 345 IKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLAQ 395


>tr|Q6YNB9|Q6YNB9_PHYPA WRKY transcription factor 1
OS=Physcomitrella patens GN=WRKY1 PE=2 SV=1
Length = 395

Score = 92.8 bits (229), Expect = 8e-18
Identities = 39/57 (68%), Positives = 48/57 (84%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVV 262
IKGSPHPRGYY+CSS+RGCPA+KHVER ++DS+MLIVTY+GDH+H Q + N V
Sbjct: 336 IKGSPHPRGYYKCSSIRGCPARKHVERSMEDSSMLIVTYEGDHNHPQSSSANGGLTV 392


>tr|B6SKM6|B6SKM6_MAIZE WRKY transcription factor 21 OS=Zea mays
PE=2 SV=1
Length = 354

Score = 92.8 bits (229), Expect = 8e-18
Identities = 41/56 (73%), Positives = 48/56 (85%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAV 265
IKGSPHPRGYY+CSSVRGCPA+KHVER VDDS MLIVTY+G+H+H +M T + V
Sbjct: 299 IKGSPHPRGYYKCSSVRGCPARKHVERCVDDSAMLIVTYEGEHNHTRMPTTQSAQV 354


>tr|A9S4W9|A9S4W9_PHYPA Transcription factor WRKY1 OS=Physcomitrella
patens subsp. patens GN=WRKY1 PE=4 SV=1
Length = 395

Score = 92.8 bits (229), Expect = 8e-18
Identities = 39/57 (68%), Positives = 48/57 (84%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQMLTENNTAVV 262
IKGSPHPRGYY+CSS+RGCPA+KHVER ++DS+MLIVTY+GDH+H Q + N V
Sbjct: 336 IKGSPHPRGYYKCSSIRGCPARKHVERSMEDSSMLIVTYEGDHNHPQSSSANGGLTV 392


>tr|Q75KW2|Q75KW2_ORYSJ Os03g0741400 protein OS=Oryza sativa subsp.
japonica GN=OJ1365_D05.15 PE=2 SV=1
Length = 387

Score = 92.4 bits (228), Expect = 1e-17
Identities = 39/49 (79%), Positives = 46/49 (93%)
Frame = -2

Query: 432 IKGSPHPRGYYRCSSVRGCPAKKHVERDVDDSNMLIVTYDGDHSHGQML 286
IKGSPHPRGYY+CSSVRGCPA+KHVER VDD +MLIVTY+GDH+H ++L
Sbjct: 334 IKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVL 382