BP921545
Clone id YMU001_000151_C05
Library
Length 496
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000151_C05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATCTTCAAGGTTTATCCTCCACAAACAAGCACCTTTCTCATTTCTTCCAACGGACGCTCA
ATGCCAAGGATGTATCATTACATGCTTTATGTCCAAGCTAGCTACTTGAATAGCTTCTGT
CATTTTGGTATACATTAAACCTGGTGTTTGCAACATCTTTGTGTAATCCAACTAATTTAA
CAACGAAGTTGTCAGAAAATTTCCTTTTTTACCTTCTGATGCAGTACTCCTTTGAGCACC
ACATTGACGTCTTTCGCACCCATGCATAAGTCTTAACCATTGAAAATATCCATCCATTGG
CACTTTCCATTCTGTAGGTAAAAAATAGGACACCCACATCCTCAATTTATGTTTGTTAAT
TGGGAAAAAATCAAGATTCCCTGCACTTTAATTTGCAAATCCAAGGCTATTGTTATCCAA
GTGCTGGTCCTACTGCTGGATAACTTGATGCAAAGTTGTCAAATGTTTTCCGTGCCTTTA
CCAACTTTCTCTTCAA
■■Homology search results ■■ -
sp_hit_id Q91X84
Definition sp|Q91X84|CRTC3_MOUSE CREB-regulated transcription coactivator 3 OS=Mus musculus
Align length 22
Score (bit) 30.4
E-value 4.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921545|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_C05.
(496 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q91X84|CRTC3_MOUSE CREB-regulated transcription coactivator 3... 30 4.7
sp|Q27YE1|L_IPPYV RNA-directed RNA polymerase OS=Ippy virus (iso... 30 6.0
sp|P03906|NU4M_PANTR NADH-ubiquinone oxidoreductase chain 4 OS=P... 30 8.0

>sp|Q91X84|CRTC3_MOUSE CREB-regulated transcription coactivator 3
OS=Mus musculus GN=Crtc3 PE=2 SV=2
Length = 619

Score = 30.4 bits (67), Expect = 4.7
Identities = 12/22 (54%), Positives = 17/22 (77%)
Frame = +2

Query: 2 SSRFILHKQAPFSFLPTDAQCQ 67
+S+ + +Q+P SFLPTDAQ Q
Sbjct: 420 ASQMVTSEQSPLSFLPTDAQAQ 441


>sp|Q27YE1|L_IPPYV RNA-directed RNA polymerase OS=Ippy virus
(isolate Rat/Central African Republic/Dak An B 188
d/1970) GN=L PE=3 SV=1
Length = 2208

Score = 30.0 bits (66), Expect = 6.0
Identities = 10/38 (26%), Positives = 22/38 (57%)
Frame = +3

Query: 141 LVFATSLCNPTNLTTKLSENFLFYLLMQYSFEHHIDVF 254
++ LC P+ + KL +N ++++ S HH+++F
Sbjct: 617 MILLVILCQPSKRSQKLLQNLRYFIMAFVSDYHHVELF 654


>sp|P03906|NU4M_PANTR NADH-ubiquinone oxidoreductase chain 4 OS=Pan
troglodytes GN=MT-ND4 PE=3 SV=2
Length = 459

Score = 29.6 bits (65), Expect = 8.0
Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 7/98 (7%)
Frame = -2

Query: 339 MWVSYFLPTEWKVPMDGYFQWLRLMHGCERRQCGAQRSTA---SEGKKGNFLTTSLLN*L 169
MW++Y + K+P+ G WL H E G+ A G G T +LN L
Sbjct: 195 MWLAYTMAFMVKMPLYGLHLWLPKAH-VEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPL 253

Query: 168 DYTKMLQTPGLMYTK----MTEAIQVASLDIKHVMIHP 67
TK + P LM + MT +I + D+K ++ +P
Sbjct: 254 --TKHMAYPFLMLSLWGMIMTSSICLRQTDLKSLIAYP 289


tr_hit_id Q7ZHX1
Definition tr|Q7ZHX1|Q7ZHX1_9HIV1 Envelope glycoprotein (Fragment) OS=Human immunodeficiency virus 1
Align length 60
Score (bit) 35.4
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921545|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_C05.
(496 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7ZHX1|Q7ZHX1_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 1.5
tr|Q7ZHY0|Q7ZHY0_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHX5|Q7ZHX5_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHX3|Q7ZHX3_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHW7|Q7ZHW7_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHW3|Q7ZHW3_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHW1|Q7ZHW1_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHV9|Q7ZHV9_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHV8|Q7ZHV8_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|Q7ZHV7|Q7ZHV7_9HIV1 Envelope glycoprotein (Fragment) OS=Human... 35 2.0
tr|A5K7D6|A5K7D6_PLAVI Putative uncharacterized protein OS=Plasm... 34 3.3
tr|Q2MEB9|Q2MEB9_9HIV1 Envelope glycoprotein gp120 (Fragment) OS... 34 3.4
tr|Q9YKS8|Q9YKS8_9HIV1 Env OS=Human immunodeficiency virus 1 GN=... 33 9.8

>tr|Q7ZHX1|Q7ZHX1_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 265

Score = 35.4 bits (80), Expect = 1.5
Identities = 22/60 (36%), Positives = 28/60 (46%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLDFFPINKHKLRMWVSYFLPTEWKVPMDGYFQW 277
TLHQVI+Q QH N ++ FAN S G+L+ I H +F G F W
Sbjct: 213 TLHQVIKQLKQHFTNKTIRFANSSGGDLE---ITTHSFNCGGEFFY-----CNTSGLFNW 264


>tr|Q7ZHY0|Q7ZHY0_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 261

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 209 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 237


>tr|Q7ZHX5|Q7ZHX5_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 260

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 208 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 236


>tr|Q7ZHX3|Q7ZHX3_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 265

Score = 35.0 bits (79), Expect = 2.0
Identities = 22/60 (36%), Positives = 28/60 (46%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLDFFPINKHKLRMWVSYFLPTEWKVPMDGYFQW 277
TLHQVI+Q QH N ++ FAN S G+L+ I H +F G F W
Sbjct: 213 TLHQVIKQLKQHFTNKTVRFANSSGGDLE---ITTHSFNRGGEFFY-----CNTSGLFNW 264


>tr|Q7ZHW7|Q7ZHW7_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 266

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 214 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 242


>tr|Q7ZHW3|Q7ZHW3_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 266

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 214 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 242


>tr|Q7ZHW1|Q7ZHW1_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 265

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 213 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 241


>tr|Q7ZHV9|Q7ZHV9_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 266

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 214 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 242


>tr|Q7ZHV8|Q7ZHV8_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 260

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 208 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 236


>tr|Q7ZHV7|Q7ZHV7_9HIV1 Envelope glycoprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=env PE=4 SV=1
Length = 266

Score = 35.0 bits (79), Expect = 2.0
Identities = 16/29 (55%), Positives = 21/29 (72%)
Frame = -2

Query: 456 TLHQVIQQ*DQHLDNNSLGFAN*SAGNLD 370
TLHQVI+Q QH N ++ FAN S G+L+
Sbjct: 214 TLHQVIKQLKQHFTNKTIRFANSSGGDLE 242