BP921555
Clone id YMU001_000151_D07
Library
Length 430
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000151_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAGAACTCAACTGCAACAGACAAAAGATTGACGAACTTAAAGCTCTTGCAAATTCTAGG
CAGAAAGAGATATTTATGCTCAATGTCAGACTTGCGGAAGCTGAAAGTATGACACATGAT
GTGATAAGAGATTTAGTTGGAGTAAAGCTAGACATTACAAACTACGCGGCTTTAGTGAGT
CATGAGCAAGGCCAAAATAATGTAGCCAATGTGGTTTTGCCAAGTCACCTGGCTGGAGAA
AAGGATAAAGAATTAACAAATCTGAAGGCCCAACTCAACGACTTCATTGATGAACGAGAA
AGCTGGCTTGAAGAAATCAATCGAATGCAAGCTGAAATGATGACTGCTCGTGTTGCTGCT
GAGAAATTGCGCCAAAGGGATCAGCTTCTCAGTACAGAACTTGAAACACTGAAAGTCGAA
AATGTTAGCC
■■Homology search results ■■ -
sp_hit_id Q6RT24
Definition sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus
Align length 134
Score (bit) 41.2
E-value 0.002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921555|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_D07.
(430 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus mus... 41 0.002
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains ... 39 0.007
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sa... 39 0.007
sp|P43047|Y864_MYCCT Uncharacterized protein MCAP_0864 OS=Mycopl... 39 0.012
sp|Q6A078|CE290_MOUSE Centrosomal protein of 290 kDa OS=Mus musc... 38 0.020
sp|Q9GL21|UACA_CANFA Uveal autoantigen with coiled-coil domains ... 37 0.026
sp|Q9BMM8|MYSP_SARSC Paramyosin OS=Sarcoptes scabiei PE=2 SV=1 37 0.034
sp|Q967Z0|MYSP_DERFA Paramyosin (Fragment) OS=Dermatophagoides f... 37 0.034
sp|P25386|USO1_YEAST Intracellular protein transport protein USO... 37 0.045
sp|Q28628|AKAP9_RABIT A-kinase anchor protein 9 (Fragment) OS=Or... 37 0.045
sp|Q60563|SYCP1_MESAU Synaptonemal complex protein 1 (Fragment) ... 36 0.058
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains ... 35 0.100
sp|Q99996|AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens ... 35 0.100
sp|Q8MUF6|MYSP_BLOTA Paramyosin OS=Blomia tropicalis PE=1 SV=1 35 0.13
sp|P30141|MRP4_STRPY Fibrinogen- and Ig-binding protein OS=Strep... 35 0.13
sp|Q8NG31|CASC5_HUMAN Protein CASC5 OS=Homo sapiens GN=CASC5 PE=... 35 0.13
sp|Q49419|Y328_MYCGE Uncharacterized protein MG328 OS=Mycoplasma... 34 0.22
sp|Q54G05|LRRX1_DICDI Putative leucine-rich repeat-containing pr... 34 0.29
sp|P75471|HMW2_MYCPN Cytadherence high molecular weight protein ... 34 0.29
sp|Q9D952|EVPL_MOUSE Envoplakin OS=Mus musculus GN=Evpl PE=2 SV=2 34 0.29
sp|Q92817|EVPL_HUMAN Envoplakin OS=Homo sapiens GN=EVPL PE=1 SV=2 34 0.29
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS... 33 0.38
sp|Q5JHN1|RAD50_PYRKO DNA double-strand break repair rad50 ATPas... 33 0.38
sp|Q9Y623|MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=1 SV=2 33 0.38
sp|Q15431|SYCP1_HUMAN Synaptonemal complex protein 1 OS=Homo sap... 33 0.49
sp|Q8AV28|PCM1_CHICK Pericentriolar material 1 protein OS=Gallus... 33 0.49
sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophil... 33 0.49
sp|P47460|HMW2_MYCGE Cytadherence high molecular weight protein ... 33 0.49
sp|Q3V6T2|GRDN_HUMAN Girdin OS=Homo sapiens GN=CCDC88A PE=1 SV=2 33 0.49
sp|Q0WVL7|GOGC5_ARATH Golgin candidate 5 OS=Arabidopsis thaliana... 33 0.49

>sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus
GN=Cenpe PE=1 SV=1
Length = 2474

Score = 41.2 bits (95), Expect = 0.002
Identities = 34/134 (25%), Positives = 67/134 (50%)
Frame = +1

Query: 19 RQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQGQN 198
++KI+EL + +I M +L + M D+ ++L +I+ +ALV G+
Sbjct: 655 KEKINELSDSRKQMESDIQMYQRQLEAKKKMQTDLDKELQLAFQEISKLSALVD---GKG 711

Query: 199 NVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAAEKLRQR 378
++N+ E +K +T+L+ +LN +E+++ EE+N + +E+ + E LR+
Sbjct: 712 LLSNL--------ELEKRITDLQKELNKEAEEKQTLQEEVN-LLSELKSLPSEVETLRRE 762

Query: 379 DQLLSTELETLKVE 420
S EL + E
Sbjct: 763 LYEKSEELHIITTE 776



Score = 36.6 bits (83), Expect = 0.045
Identities = 28/125 (22%), Positives = 61/125 (48%), Gaps = 2/125 (1%)
Frame = +1

Query: 19 RQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQGQN 198
++ ++E +++E+ + +V L E + T + +R +V ++Y +SH QG
Sbjct: 1607 KKSLEETVTKGMEKEEELRVAHVHLEEHQE-TINKLRKMV------SDYTDEISHTQGDL 1659

Query: 199 NVANVVLPSHLAG--EKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAAEKLR 372
N V+ + EK+ +L+ +KA L + +D+ E +++ + + + + EKL
Sbjct: 1660 KHTNAVVEAQNQDLREKEHQLSQVKADLRETVDQMEQLKKKLEAQSSTLESREI--EKLE 1717

Query: 373 QRDQL 387
QL
Sbjct: 1718 LTQQL 1722


>sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and
ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2
Length = 1416

Score = 39.3 bits (90), Expect = 0.007
Identities = 32/135 (23%), Positives = 68/135 (50%), Gaps = 13/135 (9%)
Frame = +1

Query: 16 NRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQ-- 189
N ++ E+ A+ N QK+ +V L + E++ + + +K ++ + EQ
Sbjct: 1093 NAKQTSEILAVQNLLQKQ----HVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQT 1148

Query: 190 ---------GQNNVANVVLPSHLAGEK--DKELTNLKAQLNDFIDERESWLEEINRMQAE 336
Q N ++V L HL ++ +KE+ +KA L + +E ++ +EE++++Q+E
Sbjct: 1149 VTKLHQLLENQKN-SSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEEVSKLQSE 1207

Query: 337 MMTARVAAEKLRQRD 381
+ + A +KL R+
Sbjct: 1208 VQNTKQALKKLETRE 1222


>sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens
GN=CENPE PE=1 SV=2
Length = 2701

Score = 39.3 bits (90), Expect = 0.007
Identities = 30/134 (22%), Positives = 66/134 (49%)
Frame = +1

Query: 19 RQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQGQN 198
++K+ EL + +I + +L + M D+ ++L +IT +L+ + ++
Sbjct: 652 KEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKLTSLIDGKVPKD 711

Query: 199 NVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAAEKLRQR 378
+ N+ E + ++T+L+ +LN ++E E+ EE+ + +E+ + E+LR+
Sbjct: 712 LLCNL--------ELEGKITDLQKELNKEVEENEALREEV-ILLSELKSLPSEVERLRKE 762

Query: 379 DQLLSTELETLKVE 420
Q S EL + E
Sbjct: 763 IQDKSEELHIITSE 776


>sp|P43047|Y864_MYCCT Uncharacterized protein MCAP_0864
OS=Mycoplasma capricolum subsp. capricolum (strain
California kid / ATCC 27343 / NCTC 10154) GN=MCAP_0864
PE=4 SV=2
Length = 470

Score = 38.5 bits (88), Expect = 0.012
Identities = 36/151 (23%), Positives = 65/151 (43%), Gaps = 11/151 (7%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESM---THDVIR--------DLVGVK 147
EE+N N+ K+D+ E+ +N ++ + ES T+D I DLV VK
Sbjct: 263 EEINNNKTKLDQ-------SDNELVNINQQIRDIESQIQNTNDEISKLKEEKEMDLVKVK 315

Query: 148 LDITNYAALVSHEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRM 327
DIT V+ + Q+N N ++ L+ Q+ ++E+ +
Sbjct: 316 SDITKINEQVNQLETQSNQTNT------------NISLLRQQIQKLDKQKETSTLNTQTL 363

Query: 328 QAEMMTARVAAEKLRQRDQLLSTELETLKVE 420
+ E+ + EKL + + ST ++ L+ E
Sbjct: 364 EKELNKKNIELEKLIKESESYSTSIKKLESE 394


>sp|Q6A078|CE290_MOUSE Centrosomal protein of 290 kDa OS=Mus
musculus GN=Cep290 PE=1 SV=2
Length = 2472

Score = 37.7 bits (86), Expect = 0.020
Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 8/150 (5%)
Frame = +1

Query: 1 EELNCNRQKIDEL-KALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALV 177
EE ++I EL +A A + KE+ RL + ES + + D V ++I N A +
Sbjct: 411 EEKTKEAERIAELAEADAREKDKELVEALKRLKDYESGVYG-LEDAV---IEIKNCKAQI 466

Query: 178 SHEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMM----- 342
G+ V KE+ L+ ++ND +DE E+ E M+
Sbjct: 467 KIRDGEMEVLT------------KEINKLEMKINDILDENEALRERAGLEPKTMIDLTEF 514

Query: 343 --TARVAAEKLRQRDQLLSTELETLKVENV 426
+ R+ ++ R +Q+L E+E+L+ E +
Sbjct: 515 RNSKRLKQQQYRAENQVLLKEIESLEEERL 544


>sp|Q9GL21|UACA_CANFA Uveal autoantigen with coiled-coil domains and
ankyrin repeats OS=Canis familiaris GN=UACA PE=2 SV=2
Length = 1415

Score = 37.4 bits (85), Expect = 0.026
Identities = 33/135 (24%), Positives = 65/135 (48%), Gaps = 13/135 (9%)
Frame = +1

Query: 16 NRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQ-- 189
N ++ EL A QK+ +V L + E++ + + +K ++ N EQ
Sbjct: 1092 NARQTSELLAAQTLLQKQ----HVPLEQVETLKKSLNSTIEHLKEELKNKQKCYEKEQQT 1147

Query: 190 ---------GQNNVANVVLPSHLAGEK--DKELTNLKAQLNDFIDERESWLEEINRMQAE 336
Q N ++V L HL ++ +KE+ +KA L + +E ++ EE++++Q+E
Sbjct: 1148 VAKLHQMLENQKN-SSVPLGEHLRVKEAFEKEVGMIKASLREKEEESQNKTEEVSKLQSE 1206

Query: 337 MMTARVAAEKLRQRD 381
+ + A +KL R+
Sbjct: 1207 VQDTKQALQKLETRE 1221


>sp|Q9BMM8|MYSP_SARSC Paramyosin OS=Sarcoptes scabiei PE=2 SV=1
Length = 876

Score = 37.0 bits (84), Expect = 0.034
Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 14/136 (10%)
Frame = +1

Query: 22 QKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQ---G 192
QK +E++AL Q EI LN+RLAEAE+ I L Y A ++ +
Sbjct: 502 QKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLK------KKYQAQITELELSLD 555

Query: 193 QNNVANVVLPSHLAGEKDKELTNLKA-------QLNDFIDERESWLEEINRMQAEMMTAR 351
N AN+ L + ++ ++T L+A QL +D+ +QAE+ R
Sbjct: 556 AANKANIDLQKTIK-KQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEQR 614

Query: 352 VAAEKL----RQRDQL 387
+A E+ RQ +QL
Sbjct: 615 IALEQANRAKRQAEQL 630


>sp|Q967Z0|MYSP_DERFA Paramyosin (Fragment) OS=Dermatophagoides
farinae PE=1 SV=1
Length = 692

Score = 37.0 bits (84), Expect = 0.034
Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 14/136 (10%)
Frame = +1

Query: 22 QKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQ---G 192
QK +E++AL Q EI LN+RLAEAE+ I L Y A ++ +
Sbjct: 416 QKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLK------KKYQAQITELELSLD 469

Query: 193 QNNVANVVLPSHLAGEKDKELTNLKA-------QLNDFIDERESWLEEINRMQAEMMTAR 351
N AN+ L + ++ ++T L+A QL +D+ +QAE+ R
Sbjct: 470 AANKANIDLQKTIK-KQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMR 528

Query: 352 VAAEKL----RQRDQL 387
+A E+ RQ +QL
Sbjct: 529 IALEQANRAKRQAEQL 544


>sp|P25386|USO1_YEAST Intracellular protein transport protein USO1
OS=Saccharomyces cerevisiae GN=USO1 PE=1 SV=2
Length = 1790

Score = 36.6 bits (83), Expect = 0.045
Identities = 31/134 (23%), Positives = 59/134 (44%)
Frame = +1

Query: 22 QKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVSHEQGQNN 201
+++ + +A S Q+E +L RL E E +LD T A S E+ +
Sbjct: 1617 RELKDKQAEIKSNQEEKELLTSRLKELEQ------------ELDSTQQKAQKSEEERRAE 1664

Query: 202 VANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAAEKLRQRD 381
V + + D++ L+ + ND +++ ++W + + T + + RQ
Sbjct: 1665 VRKFQVEK---SQLDEKAMLLETKYNDLVNKEQAWKRDED-------TVKKTTDSQRQEI 1714

Query: 382 QLLSTELETLKVEN 423
+ L+ EL+ LK EN
Sbjct: 1715 EKLAKELDNLKAEN 1728


>sp|Q28628|AKAP9_RABIT A-kinase anchor protein 9 (Fragment)
OS=Oryctolagus cuniculus GN=AKAP9 PE=2 SV=2
Length = 1087

Score = 36.6 bits (83), Expect = 0.045
Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 4/61 (6%)
Frame = +1

Query: 241 KDKELTNLKAQLNDFIDERESWLEEINRMQAEM----MTARVAAEKLRQRDQLLSTELET 408
K+KE+TNL+ QL F +E E+ EE+ ++ ++ + ++L Q ++L E+E
Sbjct: 218 KEKEITNLEEQLEQFREELENKNEEVQQLHMQLEIQKKESTTRLQELEQENKLFKDEMEK 277

Query: 409 L 411
L
Sbjct: 278 L 278


tr_hit_id A7P9D5
Definition tr|A7P9D5|A7P9D5_VITVI Chromosome chr3 scaffold_8, whole genome shotgun sequence OS=Vitis vinifera
Align length 142
Score (bit) 160.0
E-value 4.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921555|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_D07.
(430 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P9D5|A7P9D5_VITVI Chromosome chr3 scaffold_8, whole genome ... 160 4e-38
tr|Q2QMU6|Q2QMU6_ORYSJ Kinesin motor domain containing protein, ... 145 1e-33
tr|B8BMS7|B8BMS7_ORYSI Putative uncharacterized protein OS=Oryza... 145 1e-33
tr|A3CIZ7|A3CIZ7_ORYSJ Putative uncharacterized protein OS=Oryza... 145 1e-33
tr|Q0IM79|Q0IM79_ORYSJ Os12g0590500 protein OS=Oryza sativa subs... 143 5e-33
tr|A7NVX5|A7NVX5_VITVI Chromosome chr5 scaffold_2, whole genome ... 129 1e-28
tr|A5BBH5|A5BBH5_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|Q9LJ60|Q9LJ60_ARATH Kinesin (Centromeric protein)-like protei... 117 3e-25
tr|Q27IK6|Q27IK6_ARATH Kinesin POK2 OS=Arabidopsis thaliana PE=2... 117 3e-25
tr|Q27IK7|Q27IK7_ARATH Kinesin POK1 OS=Arabidopsis thaliana PE=2... 109 6e-23
tr|Q69R12|Q69R12_ORYSJ cDNA clone:001-006-F07, full insert seque... 107 4e-22
tr|Q0D4A4|Q0D4A4_ORYSJ Os07g0638000 protein (Fragment) OS=Oryza ... 107 4e-22
tr|B8B524|B8B524_ORYSI Putative uncharacterized protein OS=Oryza... 107 4e-22
tr|Q9LUT5|Q9LUT5_ARATH Kinesin-related centromere protein-like O... 97 5e-19
tr|A3BMM3|A3BMM3_ORYSJ Putative uncharacterized protein OS=Oryza... 94 3e-18
tr|A9S1F2|A9S1F2_PHYPA Predicted protein (Fragment) OS=Physcomit... 56 8e-07
tr|B4K544|B4K544_DROMO GI22998 OS=Drosophila mojavensis GN=GI229... 40 0.045
tr|A9UUF0|A9UUF0_MONBE Predicted protein OS=Monosiga brevicollis... 40 0.045
tr|A5K1N2|A5K1N2_PLAVI Putative uncharacterized protein OS=Plasm... 40 0.045
tr|A2DLG0|A2DLG0_TRIVA Viral A-type inclusion protein, putative ... 40 0.045
tr|Q0VA51|Q0VA51_XENTR LOC779447 protein (Fragment) OS=Xenopus t... 40 0.058
tr|Q4SIF0|Q4SIF0_TETNG Chromosome 5 SCAF14581, whole genome shot... 40 0.076
tr|A8E7S7|A8E7S7_DANRE Novel protein similar to vertebrate uveal... 40 0.076
tr|Q9GRG1|Q9GRG1_TETTH Tetrin A protein OS=Tetrahymena thermophi... 40 0.076
tr|B4KRC3|B4KRC3_DROMO GI19089 OS=Drosophila mojavensis GN=GI190... 40 0.076
tr|A2DD37|A2DD37_TRIVA Viral A-type inclusion protein, putative ... 40 0.076
tr|A2DBM9|A2DBM9_TRIVA Putative uncharacterized protein OS=Trich... 40 0.076
tr|Q10M62|Q10M62_ORYSJ Expressed protein (Putative uncharacteriz... 39 0.100
tr|B8ANE7|B8ANE7_ORYSI Putative uncharacterized protein OS=Oryza... 39 0.100
tr|Q9BG87|Q9BG87_BOVIN Uveal autoantigen OS=Bos taurus PE=2 SV=1 39 0.100

>tr|A7P9D5|A7P9D5_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036525001
PE=3 SV=1
Length = 2735

Score = 160 bits (404), Expect = 4e-38
Identities = 83/142 (58%), Positives = 107/142 (75%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL R +I+EL+ALA SRQKEIF LN RLA ESMTHDVIRDL+G+KLD+T Y +++
Sbjct: 2399 EELFAGRLRIEELEALAASRQKEIFALNARLAATESMTHDVIRDLLGLKLDMTKYTSVLD 2458

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
++Q Q L S + K++E+ LK QLN+F++ER+ WLEEI+R QAEM+ A++A
Sbjct: 2459 NQQVQKITEKAQLHSIESQAKEQEVIKLKQQLNEFVEERQGWLEEIDRKQAEMVAAQIAL 2518

Query: 361 EKLRQRDQLLSTELETLKVENV 426
EKLRQRDQLL TE E LK+ENV
Sbjct: 2519 EKLRQRDQLLKTENEMLKLENV 2540


>tr|Q2QMU6|Q2QMU6_ORYSJ Kinesin motor domain containing protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os12g39980 PE=3 SV=1
Length = 2793

Score = 145 bits (366), Expect = 1e-33
Identities = 70/143 (48%), Positives = 105/143 (73%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL+ +Q+I EL+ +A SRQ+EIFMLN RLA ESMTHDVIRD++GVK+++ +AALV
Sbjct: 2464 EELSAAKQRIMELEGIAASRQREIFMLNARLATTESMTHDVIRDMLGVKMNMATWAALVD 2523

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
++Q + + V +H + E+ EL L++QL++ I+ER+SWL+EIN+ Q+E+ AR+
Sbjct: 2524 NQQQMDTQESAVTQAHESKEQSDELMKLRSQLDELIEERQSWLDEINQRQSELGAARITI 2583

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
EKLRQ++ + E+E LK EN +
Sbjct: 2584 EKLRQKEHFMVAEIELLKAENAN 2606


>tr|B8BMS7|B8BMS7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38942 PE=4 SV=1
Length = 2785

Score = 145 bits (366), Expect = 1e-33
Identities = 70/143 (48%), Positives = 105/143 (73%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL+ +Q+I EL+ +A SRQ+EIFMLN RLA ESMTHDVIRD++GVK+++ +AALV
Sbjct: 2417 EELSAAKQRIMELEGIAASRQREIFMLNARLATTESMTHDVIRDMLGVKMNMATWAALVD 2476

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
++Q + + V +H + E+ EL L++QL++ I+ER+SWL+EIN+ Q+E+ AR+
Sbjct: 2477 NQQQMDTQESAVTQAHESKEQSDELMKLRSQLDELIEERQSWLDEINQRQSELGAARITI 2536

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
EKLRQ++ + E+E LK EN +
Sbjct: 2537 EKLRQKEHFMVAEIELLKAENAN 2559


>tr|A3CIZ7|A3CIZ7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_035269 PE=3 SV=1
Length = 2774

Score = 145 bits (366), Expect = 1e-33
Identities = 70/143 (48%), Positives = 105/143 (73%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL+ +Q+I EL+ +A SRQ+EIFMLN RLA ESMTHDVIRD++GVK+++ +AALV
Sbjct: 2447 EELSAAKQRIMELEGIAASRQREIFMLNARLATTESMTHDVIRDMLGVKMNMATWAALVD 2506

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
++Q + + V +H + E+ EL L++QL++ I+ER+SWL+EIN+ Q+E+ AR+
Sbjct: 2507 NQQQMDTQESAVTQAHESKEQSDELMKLRSQLDELIEERQSWLDEINQRQSELGAARITI 2566

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
EKLRQ++ + E+E LK EN +
Sbjct: 2567 EKLRQKEHFMVAEIELLKAENAN 2589


>tr|Q0IM79|Q0IM79_ORYSJ Os12g0590500 protein OS=Oryza sativa subsp.
japonica GN=Os12g0590500 PE=3 SV=1
Length = 2746

Score = 143 bits (360), Expect = 5e-33
Identities = 71/143 (49%), Positives = 105/143 (73%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL+ +Q+I EL+ +A SRQ+EIFMLN RLA ESMTHDVIRD++GVK+++ +AALV
Sbjct: 2444 EELSAAKQRIMELEGIAASRQREIFMLNARLATTESMTHDVIRDMLGVKMNMATWAALVD 2503

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
++Q + + V +H + E D EL L++QL++ I+ER+SWL+EIN+ Q+E+ AR+
Sbjct: 2504 NQQQMDTQESAVTQAHESKESD-ELMKLRSQLDELIEERQSWLDEINQRQSELGAARITI 2562

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
EKLRQ++ + E+E LK EN +
Sbjct: 2563 EKLRQKEHFMVAEIELLKAENAN 2585


>tr|A7NVX5|A7NVX5_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019702001
PE=3 SV=1
Length = 2098

Score = 129 bits (323), Expect = 1e-28
Identities = 67/143 (46%), Positives = 100/143 (69%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
+EL+ R I+EL+ LA +RQKE+ MLN RLA A+SMTHDVIRDL+GVKLD+TNYA L+
Sbjct: 1903 QELSMARLHIEELEELAANRQKEVCMLNTRLAAADSMTHDVIRDLLGVKLDMTNYADLID 1962

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
Q + + + K++E+ NLK Q++D I+ERES + EIN +A++ A++ A
Sbjct: 1963 QHQVLKLLEEAQQQTEESFAKEQEIRNLKKQIDDLIEERESCILEINSKKADIFAAQMTA 2022

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
E+L++RD LL+ + E LK++ +
Sbjct: 2023 EQLQERDHLLTAQNEMLKMDKTN 2045


>tr|A5BBH5|A5BBH5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_021056 PE=4 SV=1
Length = 1842

Score = 127 bits (319), Expect = 3e-28
Identities = 66/143 (46%), Positives = 99/143 (69%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
+EL+ R I+EL+ LA +RQKE+ MLN RLA A+SMTHDVIRDL+GVKLD+TNYA L+
Sbjct: 1608 QELSMARLHIEELEELAANRQKEVCMLNTRLAAADSMTHDVIRDLLGVKLDMTNYADLID 1667

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
Q + + + K++E+ NLK Q++D I+ERES + EIN +A++ A++
Sbjct: 1668 QHQVLKLLEEAQQQTEESFAKEQEIRNLKKQIDDLIEERESCILEINSKKADIFAAQMTV 1727

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
E+L++RD LL+ + E LK++ +
Sbjct: 1728 EQLQERDHLLTAQNEMLKMDKTN 1750


>tr|Q9LJ60|Q9LJ60_ARATH Kinesin (Centromeric protein)-like protein
OS=Arabidopsis thaliana PE=3 SV=1
Length = 2756

Score = 117 bits (293), Expect = 3e-25
Identities = 62/143 (43%), Positives = 96/143 (67%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL R +I+EL+ + ++RQKEIF+LN +LA+ +SMTHD+ R L+GVK ++TN A+ +
Sbjct: 2419 EELAAARLRIEELETVVSTRQKEIFLLNSKLAKVDSMTHDINRVLLGVKQNVTNCASFLD 2478

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
+Q + S + E+D E+++LK QLN++ ++R+ W+EEI Q E++TA++
Sbjct: 2479 SQQVLKIAEMLQHNSSDSRERDLEVSHLKQQLNEYNEKRQGWIEEIEGKQTELVTAQIKL 2538

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
E+ RQ QLL E E LK EN S
Sbjct: 2539 EEHRQYQQLLKKENELLKKENFS 2561


>tr|Q27IK6|Q27IK6_ARATH Kinesin POK2 OS=Arabidopsis thaliana PE=2 SV=1
Length = 2771

Score = 117 bits (293), Expect = 3e-25
Identities = 62/143 (43%), Positives = 96/143 (67%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
EEL R +I+EL+ + ++RQKEIF+LN +LA+ +SMTHD+ R L+GVK ++TN A+ +
Sbjct: 2434 EELAAARLRIEELETVVSTRQKEIFLLNSKLAKVDSMTHDINRVLLGVKQNVTNCASFLD 2493

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
+Q + S + E+D E+++LK QLN++ ++R+ W+EEI Q E++TA++
Sbjct: 2494 SQQVLKIAEMLQHNSSDSRERDLEVSHLKQQLNEYNEKRQGWIEEIEGKQTELVTAQIKL 2553

Query: 361 EKLRQRDQLLSTELETLKVENVS 429
E+ RQ QLL E E LK EN S
Sbjct: 2554 EEHRQYQQLLKKENELLKKENFS 2576


>tr|Q27IK7|Q27IK7_ARATH Kinesin POK1 OS=Arabidopsis thaliana PE=2 SV=1
Length = 2066

Score = 109 bits (273), Expect = 6e-23
Identities = 56/138 (40%), Positives = 90/138 (65%)
Frame = +1

Query: 1 EELNCNRQKIDELKALANSRQKEIFMLNVRLAEAESMTHDVIRDLVGVKLDITNYAALVS 180
+EL R +++EL++L +QKEI LN R+A A+SMTHDVIRDL+GVK+DIT+YA L+
Sbjct: 1842 QELTMARVRVEELESLLAVKQKEICTLNTRIAAADSMTHDVIRDLLGVKMDITSYAELID 1901

Query: 181 HEQGQNNVANVVLPSHLAGEKDKELTNLKAQLNDFIDERESWLEEINRMQAEMMTARVAA 360
Q Q V + K++E+ NLK ++ +RES + E+N+ +++ +++
Sbjct: 1902 QHQVQRVVEKAQQHAEEILSKEQEVMNLKRHIDYLFKDRESCMSELNKKDTDVLATQISL 1961

Query: 361 EKLRQRDQLLSTELETLK 414
++L++R QLLS + E LK
Sbjct: 1962 DQLQERVQLLSMQNEMLK 1979