BP921574
Clone id YMU001_000151_F06
Library
Length 480
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000151_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GATTCACCAACGGACATGTGCTCACTTCACCCACTTTATGCAGATGGAGACTCGAGCGAG
AGCTTGAAAGTGGCAGAGGCACCCGTGCTGGCAGCCGTCTTGTATTCAAGCTATCCATAA
ATGAAGGATTCGGCAATGACCCCACACTAGCAACCTCGGCGTGCATTCTCTCGCCCTATG
GATTCTTTCCACTTCATGTCTCGACCTCGTACAAGCCTGCTATAGTGGCAATCCCATGTC
TTCCACTCATGATCTCTTGCGGTACTCTTGGGAGTCCCATGCTTATGACTCACCCCATGG
ATCTTTTTCACCATGACCATCGTTAGCTGGCACTTGAAGCACCTGCAAATACTGTAGCCG
ATACAAGAGCCCATCTAGTAGGAACTCTTCTCCCCTCTTGCAGCTTCCTCTCATGCCCAT
GGGCTTTGCCTCCTTAGCATGCTCGCCCTCCGTCTGTGCGAGTCTTAGAAAACCTACAGG
■■Homology search results ■■ -
sp_hit_id Q8WXI3
Definition sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens
Align length 99
Score (bit) 31.2
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921574|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_F06.
(480 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=... 31 2.5
sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=S... 30 4.3
sp|Q6NP60|MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster... 30 7.4

>sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10
OS=Homo sapiens GN=ASB10 PE=2 SV=2
Length = 467

Score = 31.2 bits (69), Expect = 2.5
Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 4/99 (4%)
Frame = +3

Query: 189 PLHVSTSYKPAIVAIPCLPLMISCGTLGSPMLMTHPMDLFHHDHR*LALEAPANTVADTR 368
PLH++ A V + L++SCG + + MD H AL+ PA +A +
Sbjct: 297 PLHLACRRGHAAV----VELLLSCG------VSANTMDYGGHTPLHCALQGPAAALAQSP 346

Query: 369 AHLVGTLLPSCSFLSCPWALPP*HAR----PPSVRVLEN 473
H+V LL + P ALP R P ++ VL N
Sbjct: 347 EHVVRALLNHGAVRVWPGALPKVLERWSTCPRTIEVLMN 385


>sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1
OS=Schizosaccharomyces pombe GN=msc1 PE=2 SV=1
Length = 1588

Score = 30.4 bits (67), Expect = 4.3
Identities = 15/33 (45%), Positives = 19/33 (57%)
Frame = +2

Query: 161 VHSLALWILSTSCLDLVQACYSGNPMSSTHDLL 259
VH+L+ + + L QA S NPM S HDLL
Sbjct: 1380 VHTLSTTLSPWAMKSLAQAAISPNPMPSAHDLL 1412


>sp|Q6NP60|MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster
GN=olf413 PE=1 SV=1
Length = 760

Score = 29.6 bits (65), Expect = 7.4
Identities = 12/35 (34%), Positives = 19/35 (54%)
Frame = +2

Query: 209 VQACYSGNPMSSTHDLLRYSWESHAYDSPHGSFSP 313
+ C + ++ T+D +R + HA D PHGS P
Sbjct: 210 LDTCDPSHDIAITNDTMRLLYMYHAQDPPHGSVRP 244


tr_hit_id A6R4N4
Definition tr|A6R4N4|A6R4N4_AJECN Putative uncharacterized protein OS=Ajellomyces capsulata (strain NAm1 / WU24)
Align length 73
Score (bit) 36.2
E-value 0.83
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921574|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_F06.
(480 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6R4N4|A6R4N4_AJECN Putative uncharacterized protein OS=Ajell... 36 0.83
tr|A6C4T7|A6C4T7_9PLAN Glycerophosphodiester phosphodiesterase O... 34 3.2
tr|A9T1M3|A9T1M3_PHYPA Predicted protein OS=Physcomitrella paten... 33 5.4

>tr|A6R4N4|A6R4N4_AJECN Putative uncharacterized protein
OS=Ajellomyces capsulata (strain NAm1 / WU24)
GN=HCAG_04592 PE=4 SV=1
Length = 412

Score = 36.2 bits (82), Expect = 0.83
Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
Frame = +3

Query: 183 FFPLHVSTS-YKPAIVAIPCLPLMISCGTLGSPMLMTHPMDLFHHDHR*LALEAPANTVA 359
F P VS Y PA A+P PL + G+P + M HH LE ++ +
Sbjct: 238 FNPPQVSPQHYPPATSALPQRPLAFPTSSFGAPQVNAFQMQQLHHGQPSYGLEQSQSSRS 297

Query: 360 DTRAHLVGTLLPS 398
+ HLVG P+
Sbjct: 298 PSGPHLVGEQPPT 310


>tr|A6C4T7|A6C4T7_9PLAN Glycerophosphodiester phosphodiesterase
OS=Planctomyces maris DSM 8797 GN=PM8797T_20428 PE=4
SV=1
Length = 276

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/52 (36%), Positives = 28/52 (53%)
Frame = +3

Query: 222 IVAIPCLPLMISCGTLGSPMLMTHPMDLFHHDHR*LALEAPANTVADTRAHL 377
I+A+ CLP+ + T G P+++ HR L AP NT+A+ RA L
Sbjct: 11 IIAVACLPVDVRSATAGEPLIVA---------HRGLLRVAPENTLANFRACL 53


>tr|A9T1M3|A9T1M3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_232192 PE=4 SV=1
Length = 145

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/40 (42%), Positives = 22/40 (55%)
Frame = -2

Query: 371 GSCIGYSICRCFKCQLTMVMVKKIHGVSHKHGTPKSTARD 252
G+ IG IC C K L +++V HG+ H P STA D
Sbjct: 52 GALIGMEICHC-KAGLVLLLVLLYHGICHFAKLPTSTALD 90