BP921607
Clone id YMU001_000152_A09
Library
Length 562
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATCAAGTAGCAAAACATGTGTAACACACCATGTAATGCAACATTTTGCAAAAGTGTTCT
CAACACACTCAAATTGTGTGAGCTCAAAACAGTGTCAAAACGATTGCTGTGGAGCATGAT
CAGAAACCATACAGATAATAAGCGAAGCTACTACATACTGTCGAAAGTTAATGATCATGT
CAGTTAACATCACTAAGAACAATATTCCCCTTTGCTATCTTTACTGTATGCCTAACGACA
GATTTTTCACTTTCCTATCTTTCTAAATAGTCATGCCATTAATAGTACACGCACGTGACA
TCCCCTTTTCATTACTAGTGAATCTCCCAGGATCAACAAACATTCAACTACCTTTACTGA
TGAAACCAGTATTGCCTTTAAGATATGATGAAGCCTTTAAAAGGACTAGACATGTCCCAG
AACCTACTGCAAAATTTTGTACCAACCTAGCTTCAAAACATCTCTTGGCTTGGCGCATGC
TCTATATCATGAGCACAAACCTCATGAATCATATTTTACATATCAACTTGCAAACTAGAT
CCTCACTACTTTCGAGTACCTG
■■Homology search results ■■ -
sp_hit_id Q6KHN7
Definition sp|Q6KHN7|SYI_MYCMO Isoleucyl-tRNA synthetase OS=Mycoplasma mobile
Align length 32
Score (bit) 30.8
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921607|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_A09.
(562 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6KHN7|SYI_MYCMO Isoleucyl-tRNA synthetase OS=Mycoplasma mobi... 31 4.8
sp|Q8DWM9|TILS_STRMU tRNA(Ile)-lysidine synthase OS=Streptococcu... 30 8.2

>sp|Q6KHN7|SYI_MYCMO Isoleucyl-tRNA synthetase OS=Mycoplasma mobile
GN=ileS PE=3 SV=1
Length = 885

Score = 30.8 bits (68), Expect = 4.8
Identities = 11/32 (34%), Positives = 19/32 (59%)
Frame = +2

Query: 434 ILYQPSFKTSLGLAHALYHEHKPHESYFTYQL 529
+ + PS +++L A YHEHK H Y +++
Sbjct: 187 VFWSPSSQSALAEAEVEYHEHKSHSIYTAFKI 218


>sp|Q8DWM9|TILS_STRMU tRNA(Ile)-lysidine synthase OS=Streptococcus
mutans GN=tilS PE=3 SV=1
Length = 423

Score = 30.0 bits (66), Expect = 8.2
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
Frame = +2

Query: 242 IFHFPIFLN---SHAINSTRT*HPLFITSESPRINKHSTTFTDETSIAFK 382
IFHF N S+ N R + +T E+P++++H ++ET++ FK
Sbjct: 170 IFHFDDDSNQGDSYLRNRIRNHYLPILTQENPKLSQHLIQMSEETNLLFK 219


tr_hit_id B4K5M1
Definition tr|B4K5M1|B4K5M1_DROMO GI24063 OS=Drosophila mojavensis
Align length 94
Score (bit) 36.2
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921607|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_A09.
(562 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4K5M1|B4K5M1_DROMO GI24063 OS=Drosophila mojavensis GN=GI240... 36 1.2
tr|B1DGQ1|B1DGQ1_9BACL Binding-protein-dependent transport syste... 35 3.6
tr|B3P1I0|B3P1I0_DROER GG17171 OS=Drosophila erecta GN=GG17171 P... 33 8.1

>tr|B4K5M1|B4K5M1_DROMO GI24063 OS=Drosophila mojavensis GN=GI24063
PE=4 SV=1
Length = 883

Score = 36.2 bits (82), Expect = 1.2
Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
Frame = +3

Query: 288 HARDIPFSLLVNLPGSTNIQLPLLMKPVLPLRYDEAFKRTRHV---PEPTAKFCTNLASK 458
H D+ F L LPG+ LL +P+L RT+HV EP+A + N A+K
Sbjct: 499 HILDLTFCSLATLPGAKTTTYNLLGEPLL-------LNRTKHVANQTEPSAIYINN-AAK 550

Query: 459 HLLAWRMLYIMSTNLMNHILHINLQTRSSLLSST 560
L A IM TN + H++ L T S+L +T
Sbjct: 551 ILDA----DIMGTNGVLHVIDTILPTDSALPMTT 580


>tr|B1DGQ1|B1DGQ1_9BACL Binding-protein-dependent transport systems
inner membrane component OS=Paenibacillus sp. JDR-2
GN=Pjdr2DRAFT_4302 PE=3 SV=1
Length = 291

Score = 34.7 bits (78), Expect = 3.6
Identities = 25/64 (39%), Positives = 31/64 (48%)
Frame = +3

Query: 216 YLYCMPNDRFFTFLSF*IVMPLIVHARDIPFSLLVNLPGSTNIQLPLLMKPVLPLRYDEA 395
Y+ PN F FL F IV+ ++ H IP LLVN G N LL+ PV Y+
Sbjct: 97 YVLSRPNLYFRHFLMFLIVLTMVFHGGLIPSYLLVNKLGMMNTMWALLI-PVAINTYNLI 155

Query: 396 FKRT 407
RT
Sbjct: 156 IMRT 159


>tr|B3P1I0|B3P1I0_DROER GG17171 OS=Drosophila erecta GN=GG17171 PE=4
SV=1
Length = 843

Score = 33.5 bits (75), Expect = 8.1
Identities = 30/91 (32%), Positives = 44/91 (48%)
Frame = +3

Query: 288 HARDIPFSLLVNLPGSTNIQLPLLMKPVLPLRYDEAFKRTRHVPEPTAKFCTNLASKHLL 467
H D+ F L +PG+ LL +P+L R + A +T PT + NLA K +
Sbjct: 460 HLLDLTFCSLATVPGAKTTAYNLLGEPLLLNRTNRAANQT----GPTPIYINNLA-KIIE 514

Query: 468 AWRMLYIMSTNLMNHILHINLQTRSSLLSST 560
A IM TN + H++ L T S+L +T
Sbjct: 515 A----DIMGTNGVLHVIDTILPTESALPMTT 541