BP921635
Clone id YMU001_000152_D06
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_D06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGATTCTTGCTGCAGCAACAGAGGCTGCCACAGCCTGAGCAGAGATAAAGGCTTCTTT
ACTTTTGTCTGCCAGCTTCTCACGTCCAACATCCTGTATTGGCGGCACGGGTGGTAAATA
GTCCTTTGCAGATTCCCCTTTAGGTCGATCATTATAGCCAATGACTTTGTTTGTACAAGG
TTTTGCATTGTTCAGTGTCCGGATTTCCTCTATAGGTATGTGAGCTTTCTCCTCGGGCTT
CATGTTCATCATCTTCTCACACATAGCTTTTGCATTGATATACTGCTCCTTGAGCTCCTT
GTTATCTGGCTCCAATCGTAACGCAAATTCCGAGTCAGCAACTGCACCCAAAAGGTTGCC
TAGTTCTTTTCTAGCAGTGGCTCTCCGTGAGTATGCCTTTATGTATCTGTCATCTAAAGC
AAGGGCCTCCGTACAATCTACTTCAGCTTCTTGAAATCTTCTAATTTTAATGCATGCCAT
AGCTCTATTTGCATATGACACAGCCGATGGTTGCAATACTATGCTTCGAGAATAGCATTC
AATAGC
■■Homology search results ■■ -
sp_hit_id Q5ZKQ3
Definition sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus
Align length 123
Score (bit) 84.7
E-value 3.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921635|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_D06.
(546 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=... 85 3e-16
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=... 84 6e-16
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=... 83 8e-16
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Ra... 81 3e-15
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=... 80 8e-15
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=... 76 9e-14
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus... 70 5e-12
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rat... 70 5e-12
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=H... 70 9e-12
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=M... 69 1e-11
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 ... 67 4e-11
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repe... 67 7e-11
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegi... 66 1e-10
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat... 66 1e-10
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repe... 66 1e-10
sp|Q84XU2|PPP5_ARATH Serine/threonine protein phosphatase 5 OS=A... 64 5e-10
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM3... 63 8e-10
sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM3... 63 8e-10
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM3... 63 8e-10
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repea... 62 2e-09
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog ... 61 3e-09
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens... 61 4e-09
sp|Q84K11|PPP5_SOLLC Serine/threonine protein phosphatase 5 OS=S... 60 7e-09
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repe... 58 3e-08
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repe... 57 6e-08
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus m... 57 8e-08
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom-... 56 1e-07
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat... 56 1e-07
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repe... 56 1e-07
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo ... 56 1e-07

>sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3
OS=Gallus gallus GN=RPAP3 PE=2 SV=1
Length = 665

Score = 84.7 bits (208), Expect = 3e-16
Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQ-PSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R I +A+ ANRAMA +KI++++EAE DCT+AL LD Y KA++RR AR
Sbjct: 302 AIECYTRGIAADGTNALLPANRAMAYLKIQKYEEAENDCTQALLLDASYSKAFARRGAAR 361

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAHIPIEEIRTLN 190
LG L A+ D E L+LEP NK+ + + + EE + I+E N
Sbjct: 362 VALGKLKEAMQDFEAVLKLEPGNKQAINELTKIRNELAEKEQSCHEEYPAVLIKESEIKN 421

Query: 189 NAK 181
K
Sbjct: 422 IVK 424



Score = 69.7 bits (169), Expect = 9e-12
Identities = 40/89 (44%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+CY+R + P + V NRA A ++++F AE DC ALALD Y KAY+RR AR
Sbjct: 152 AIKCYTRGMHSDPFNPVLPTNRASAFYRMKKFSVAESDCNLALALDKNYTKAYARRGAAR 211

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQ 283
L N GA D E L L+ +N E K +
Sbjct: 212 FALKNFQGAKEDYEKVLELDANNYEAKNE 240


>sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus
musculus GN=Rpap3 PE=1 SV=1
Length = 660

Score = 83.6 bits (205), Expect = 6e-16
Identities = 45/85 (52%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
Frame = -1

Query: 546 AIECYSRSIVL-QPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R I + +A+ ANRAMA +KI+R++EAE DCT+A+ LD Y KA++RR TAR
Sbjct: 303 AIECYTRGIAADRTNALLPANRAMAYLKIQRYEEAERDCTQAIVLDGSYSKAFARRGTAR 362

Query: 369 KELGNLLGAVADSEFALRLEPDNKE 295
LG + A D E L LEP NK+
Sbjct: 363 TFLGKINEAKQDFETVLLLEPGNKQ 387



Score = 66.2 bits (160), Expect = 1e-10
Identities = 39/85 (45%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY++ + P + V NRA A ++++F AE DC A+AL Y KAY+RR AR
Sbjct: 153 AIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAIALSRTYTKAYARRGAAR 212

Query: 369 KELGNLLGAVADSEFALRLEPDNKE 295
L L A D E L LEPDN E
Sbjct: 213 FALQKLEDARKDYEKVLELEPDNFE 237


>sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3
OS=Homo sapiens GN=RPAP3 PE=1 SV=2
Length = 665

Score = 83.2 bits (204), Expect = 8e-16
Identities = 52/137 (37%), Positives = 75/137 (54%), Gaps = 8/137 (5%)
Frame = -1

Query: 546 AIECYSRSIVLQ-PSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R I +A+ ANRAMA +KI++++EAE DCT+A+ LD Y KA++RR TAR
Sbjct: 301 AIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTAR 360

Query: 369 KELGNLLGAVADSEFALRLEPDNKE-------LKEQYINAKAMCEKMMNMKPEEKAHIPI 211
LG L A D E L LEP NK+ +K++ I + ++ + PI
Sbjct: 361 TFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI 420

Query: 210 EEIRTLNNAKPCTNKVI 160
+ + KP +I
Sbjct: 421 DNPPHPGSTKPLKKVII 437



Score = 65.9 bits (159), Expect = 1e-10
Identities = 41/107 (38%), Positives = 55/107 (51%), Gaps = 1/107 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+CY++ + P + V NRA A ++++F AE DC A+AL+ Y KAYSRR AR
Sbjct: 152 AIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAAR 211

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEE 229
L L A D E L LEP+N E + N P+E
Sbjct: 212 FALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKE 258


>sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3
OS=Rattus norvegicus GN=Rpap3 PE=2 SV=1
Length = 659

Score = 81.3 bits (199), Expect = 3e-15
Identities = 43/85 (50%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
Frame = -1

Query: 546 AIECYSRSIVLQPS-AVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R I + A+ ANRAMA +K+++++EAE DCT+A+ LD Y KA++RR TAR
Sbjct: 301 AIECYTRGIAADSTNALLPANRAMAYLKVQKYEEAERDCTQAILLDGSYSKAFARRGTAR 360

Query: 369 KELGNLLGAVADSEFALRLEPDNKE 295
LG + A D E L LEP NK+
Sbjct: 361 TFLGKINEAKQDFETVLLLEPGNKQ 385



Score = 68.6 bits (166), Expect = 2e-11
Identities = 49/140 (35%), Positives = 64/140 (45%), Gaps = 3/140 (2%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY++ + P + V NRA A ++++F AE DC A+AL Y KAY+RR AR
Sbjct: 152 AIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAIALSRSYTKAYARRGAAR 211

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAHI--PIEEIRT 196
L L A D L LEPDN E + N P++ A + P E R
Sbjct: 212 FALQKLEDARKDYVKVLELEPDNFEATNELRKIDQALTSKENSHPKDIAAVIKPAEGERK 271

Query: 195 LNNAKPCTNKVIGYNDRPKG 136
N + K I D G
Sbjct: 272 ANEDQRGRQKAIAEKDLGNG 291


>sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3
OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1
Length = 657

Score = 79.7 bits (195), Expect = 8e-15
Identities = 52/133 (39%), Positives = 77/133 (57%), Gaps = 4/133 (3%)
Frame = -1

Query: 546 AIECYSRSIVLQPS-AVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+CYS+ + + A+ ANRAMA +KI++++EAE DCT A++LD Y KA++RR TAR
Sbjct: 303 AIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISLDASYCKAFARRGTAR 362

Query: 369 KELGNLLGAVADSEFALRLEPDNKE--LKEQYINAKAMC-EKMMNMKPEEKAHIPIEEIR 199
LG A D E L+L+P NK+ L+ + I+ + EK E K +E++
Sbjct: 363 IMLGKQKEAKEDFEMVLKLDPGNKQAVLELEKISRELRSNEKDTKGNKERKLINAVEKLP 422

Query: 198 TLNNAKPCTNKVI 160
+ KP VI
Sbjct: 423 HQRSTKPLRRMVI 435



Score = 70.5 bits (171), Expect = 5e-12
Identities = 49/129 (37%), Positives = 69/129 (53%), Gaps = 15/129 (11%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R + P +AV NRA A +++++ AE DC A+AL+ Y KAY+RR AR
Sbjct: 151 AIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAAR 210

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQY--IN------------AKAMCEKMMNMKPE 232
L +L GA D E L L+ +N E K + IN +A+ EK+ E
Sbjct: 211 LALKDLQGAKEDYEKVLELDVNNFEAKNELRKINKELQSSTSDVQEKEAIEEKITVENEE 270

Query: 231 EKAHIPIEE 205
EK I I++
Sbjct: 271 EKKQIEIQQ 279


>sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3
OS=Xenopus laevis GN=rpap3 PE=2 SV=1
Length = 660

Score = 76.3 bits (186), Expect = 9e-14
Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
Frame = -1

Query: 546 AIECYSRSIVLQ-PSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECYS+ + +A+ ANRAMA +KI++++EAE DCT A++LD Y KA++RR TA
Sbjct: 303 AIECYSQGMEADNTNALLPANRAMAYLKIQKYKEAEADCTLAISLDASYCKAFARRGTAS 362

Query: 369 KELGNLLGAVADSEFALRLEPDNKE 295
LG A D E L+L+P NK+
Sbjct: 363 IMLGKQKEAKEDFEMVLKLDPGNKQ 387



Score = 72.4 bits (176), Expect = 1e-12
Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIECY+R + P +A+ NRA A ++++F AE DC A+AL+ Y KAY+RR AR
Sbjct: 151 AIECYTRGMDADPYNAILPTNRASAFFRLKKFAVAESDCNLAIALNRDYAKAYARRGAAR 210

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQY--INAK---AMCEKMMNMKPEEKAHIPIEE 205
L NL GA D E L L+ +N E K + IN + + + NM E K + EE
Sbjct: 211 LALKNLQGAKEDYEKVLELDANNFEAKNELRKINQELYSSASDVQENMATEAKITVENEE 270


>sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus
GN=Spag1 PE=2 SV=1
Length = 901

Score = 70.5 bits (171), Expect = 5e-12
Identities = 45/117 (38%), Positives = 64/117 (54%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
A+ Y+RS+ P+A++Y NRA A IK++R+ A DC +AL LD +KA RRAT K
Sbjct: 232 AVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYK 291

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAHIPIEEIRT 196
L AV D L++EPDN K K + E ++K E P+ E++T
Sbjct: 292 HQNKLQEAVDDLRKVLQVEPDNDLAK------KTLSEVERDLKNSE----PVSELQT 338



Score = 55.8 bits (133), Expect = 1e-07
Identities = 45/162 (27%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVS-YANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI Y+ + + A + Y NRA+ +K+ +F+EA++DC +AL +D +KA R A A+
Sbjct: 625 AISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQ 684

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAHIPIEEIRTLN 190
K L N + D L L PD+ E ++++ K + K E+ I ++E+ +
Sbjct: 685 KGLENCRESGVDPSQVL-LSPDSSE-AARHLDTKN--DTAPPSKGRERRRIQVQEVDGSS 740

Query: 189 NAKPCTNKVIGYNDRPKGESAKDYLPPVPPIQDVGREKLADK 64
+ +P +RP E++ P ++D G + A+K
Sbjct: 741 DEEP---------ERP-AEASATSAPARDGVEDGGSAEPAEK 772



Score = 32.3 bits (72), Expect = 1.5
Identities = 19/65 (29%), Positives = 31/65 (47%)
Frame = -1

Query: 504 AVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARKELGNLLGAVADSEF 325
++ Y+NRA +K ++ DC AL L +K RRA A + L A D +
Sbjct: 472 SILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKT 531

Query: 324 ALRLE 310
L+++
Sbjct: 532 VLQID 536


>sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus
norvegicus GN=Ppp5c PE=2 SV=1
Length = 499

Score = 70.5 bits (171), Expect = 5e-12
Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 1/109 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQPS-AVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+ YS++I L PS A+ Y NR++A ++ + A D T A+ LD +YIK Y RRA +
Sbjct: 47 AIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASN 106

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKA 223
LG A+ D E ++++P++K+ K +Y C K++ K E+A
Sbjct: 107 MALGKFRAALRDYETVVKVKPNDKDAKMKY----QECSKIVKQKAFERA 151


>sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo
sapiens GN=PPP5C PE=1 SV=1
Length = 499

Score = 69.7 bits (169), Expect = 9e-12
Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 1/109 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQPS-AVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+ YS++I L PS A+ Y NR++A ++ + A D T A+ LD +YIK Y RRA +
Sbjct: 47 AIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASN 106

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKA 223
LG A+ D E ++++P +K+ K +Y C K++ K E+A
Sbjct: 107 MALGKFRAALRDYETVVKVKPHDKDAKMKY----QECNKIVKQKAFERA 151


>sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus
musculus GN=Ppp5c PE=2 SV=2
Length = 499

Score = 69.3 bits (168), Expect = 1e-11
Identities = 39/109 (35%), Positives = 64/109 (58%), Gaps = 1/109 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AI+ YS++I L P +A+ Y NR++A ++ + A D T A+ LD +YIK Y RRA +
Sbjct: 47 AIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASN 106

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKA 223
LG A+ D E ++++P++K+ K +Y C K++ K E+A
Sbjct: 107 MALGKFRAALRDYETVVKVKPNDKDAKMKY----QECSKIVKQKAFERA 151


tr_hit_id A9NZZ1
Definition tr|A9NZZ1|A9NZZ1_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 118
Score (bit) 155.0
E-value 1.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921635|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_D06.
(546 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NZZ1|A9NZZ1_PICSI Putative uncharacterized protein OS=Picea... 155 1e-36
tr|Q5XF05|Q5XF05_ARATH At1g56440 (Putative uncharacterized prote... 142 9e-33
tr|B4FCP2|B4FCP2_MAIZE Putative uncharacterized protein OS=Zea m... 136 8e-31
tr|Q9C7X4|Q9C7X4_ARATH Putative uncharacterized protein F13N6.2 ... 131 2e-29
tr|Q0DL11|Q0DL11_ORYSJ Os05g0129900 protein OS=Oryza sativa subs... 131 2e-29
tr|B8AXL1|B8AXL1_ORYSI Putative uncharacterized protein OS=Oryza... 123 7e-27
tr|A9TLT3|A9TLT3_PHYPA Predicted protein (Fragment) OS=Physcomit... 121 3e-26
tr|Q688Q3|Q688Q3_ORYSJ Unknow protein (Putative uncharacterized ... 106 7e-22
tr|A7PRR0|A7PRR0_VITVI Chromosome chr14 scaffold_27, whole genom... 100 4e-20
tr|A4S4X9|A4S4X9_OSTLU Predicted protein OS=Ostreococcus lucimar... 86 1e-15
tr|Q4SST5|Q4SST5_TETNG Chromosome undetermined SCAF14347, whole ... 86 1e-15
tr|A4RRQ1|A4RRQ1_OSTLU Predicted protein OS=Ostreococcus lucimar... 85 3e-15
tr|B4DRW9|B4DRW9_HUMAN cDNA FLJ50185, weakly similar to Homo sap... 83 8e-15
tr|A7T0P9|A7T0P9_NEMVE Predicted protein OS=Nematostella vectens... 82 1e-14
tr|B6MWU6|B6MWU6_BRAFL Putative uncharacterized protein OS=Branc... 81 4e-14
tr|B6MWS0|B6MWS0_BRAFL Putative uncharacterized protein OS=Branc... 81 4e-14
tr|A9UV33|A9UV33_MONBE Predicted protein OS=Monosiga brevicollis... 80 5e-14
tr|A9U0V2|A9U0V2_PHYPA Predicted protein OS=Physcomitrella paten... 80 7e-14
tr|Q2F643|Q2F643_BOMMO TPR-repeat protein OS=Bombyx mori PE=2 SV=1 79 1e-13
tr|Q5DCK3|Q5DCK3_SCHJA SJCHGC00908 protein OS=Schistosoma japoni... 78 3e-13
tr|A7SN44|A7SN44_NEMVE Predicted protein (Fragment) OS=Nematoste... 78 3e-13
tr|Q00YQ2|Q00YQ2_OSTTA Chloroplast Toc64-2 (ISS) OS=Ostreococcus... 78 3e-13
tr|Q9LVH5|Q9LVH5_ARATH Gb|AAB70409.1 OS=Arabidopsis thaliana GN=... 77 8e-13
tr|B5X4C5|B5X4C5_SALSA RNA polymerase II-associated protein 3 OS... 75 2e-12
tr|Q4RFT2|Q4RFT2_TETNG Serine/threonine protein phosphatase (Fra... 72 2e-11
tr|A7SYL2|A7SYL2_NEMVE Predicted protein OS=Nematostella vectens... 72 2e-11
tr|A7PH66|A7PH66_VITVI Chromosome chr17 scaffold_16, whole genom... 71 3e-11
tr|Q5ZJ95|Q5ZJ95_CHICK Putative uncharacterized protein OS=Gallu... 71 4e-11
tr|Q64538|Q64538_RAT Serine/threonine protein phosphatase (Fragm... 70 6e-11
tr|Q585V5|Q585V5_9TRYP TPR-repeat protein, putative OS=Trypanoso... 70 6e-11

>tr|A9NZZ1|A9NZZ1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 369

Score = 155 bits (392), Expect = 1e-36
Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 1/118 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
AI+CYSRSIVLQP+AV++ANRAMA IK+RRF+EAE DC+EA+ LDDRY+KAYSRR TA+K
Sbjct: 19 AIDCYSRSIVLQPTAVAFANRAMAYIKMRRFEEAEYDCSEAIDLDDRYVKAYSRRGTAKK 78

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMC-EKMMNMKPEEKAHIPIEEIRT 196
ELG LL A+ D EFALRLEP+NKELK+QY A+ M E + PE+KA + IEE+++
Sbjct: 79 ELGKLLDAIDDFEFALRLEPENKELKKQYEEARRMYGESIAKKIPEKKARVGIEELKS 136


>tr|Q5XF05|Q5XF05_ARATH At1g56440 (Putative uncharacterized protein
At1g56440) OS=Arabidopsis thaliana GN=At1g56440 PE=2
SV=1
Length = 476

Score = 142 bits (359), Expect = 9e-33
Identities = 70/98 (71%), Positives = 86/98 (87%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
AI+CYSRSI L P+AV+YANRAMA +KI+R++EAEVDCTEAL LDDRYIKAYSRRATARK
Sbjct: 103 AIDCYSRSIALSPNAVTYANRAMAYLKIKRYREAEVDCTEALNLDDRYIKAYSRRATARK 162

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEK 253
ELG + A D+EFALRLEP+++ELK+QY + K++ EK
Sbjct: 163 ELGMIKEAKEDAEFALRLEPESQELKKQYADIKSLLEK 200


>tr|B4FCP2|B4FCP2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 397

Score = 136 bits (342), Expect = 8e-31
Identities = 79/158 (50%), Positives = 103/158 (65%), Gaps = 1/158 (0%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
AIECYSRSI L P+AV++ANRAMA +K+RRF+EAE DCTEAL LDDRYIKAYSRR TARK
Sbjct: 57 AIECYSRSIGLSPTAVTFANRAMAYLKLRRFKEAEDDCTEALNLDDRYIKAYSRRITARK 116

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAHIPIEEIRTLNN 187
ELG L A+ D+EFA+ L+P+N EL++QY KA+ + M K +P+ R ++
Sbjct: 117 ELGKLKEAMDDAEFAISLDPNNSELRKQYSEIKALHMEKMAKK------VPVPAKRAVSG 170

Query: 186 AKPCTNKVIGYNDRPKGESAKDYLPPVP-PIQDVGREK 76
+K P S KD + V P++D + K
Sbjct: 171 ----IDKTADVTSHPPTISQKDTIMEVDLPVRDAMKIK 204


>tr|Q9C7X4|Q9C7X4_ARATH Putative uncharacterized protein F13N6.2
OS=Arabidopsis thaliana GN=F13N6.2 PE=4 SV=1
Length = 242

Score = 131 bits (330), Expect = 2e-29
Identities = 70/112 (62%), Positives = 84/112 (75%), Gaps = 14/112 (12%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQE--------------AEVDCTEALALDD 409
AI+CYSRSI L P+AV+YANRAMA +KI+RF AEVDCTEAL LDD
Sbjct: 103 AIDCYSRSIALSPNAVTYANRAMAYLKIKRFAHCLFHWFYSFITVTLAEVDCTEALNLDD 162

Query: 408 RYIKAYSRRATARKELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEK 253
RYIKAYSRRATARKELG + A D+EFALRLEP+++ELK+QY + K++ EK
Sbjct: 163 RYIKAYSRRATARKELGMIKEAKEDAEFALRLEPESQELKKQYADIKSLLEK 214


>tr|Q0DL11|Q0DL11_ORYSJ Os05g0129900 protein OS=Oryza sativa subsp.
japonica GN=Os05g0129900 PE=2 SV=1
Length = 397

Score = 131 bits (330), Expect = 2e-29
Identities = 66/109 (60%), Positives = 84/109 (77%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
AIECYSRSI L PSAV++ANRAMA +K+RRF+EAE DCTEAL LDDRY+KAYSRR TARK
Sbjct: 59 AIECYSRSIGLSPSAVAFANRAMAYLKLRRFEEAENDCTEALNLDDRYVKAYSRRITARK 118

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAH 220
ELG L A+ D+EFA+ ++P+N EL++QY K + K + + + H
Sbjct: 119 ELGKLKEAMDDAEFAVSIDPNNPELRKQYSEIKELHMKEVANRSKPTKH 167


>tr|B8AXL1|B8AXL1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_18314 PE=4 SV=1
Length = 408

Score = 123 bits (308), Expect = 7e-27
Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRR-----------FQEAEVDCTEALALDDRYI 400
AIECYSRSI L PSAV++ANRAMA +K+RR F+EAE DCTEAL LDDRY+
Sbjct: 59 AIECYSRSIGLSPSAVAFANRAMAYLKLRRQSYIFYVIFTRFEEAENDCTEALNLDDRYV 118

Query: 399 KAYSRRATARKELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAH 220
KAYSRR TARKELG L A+ D+EFA+ ++P+N EL++QY K + K + + + H
Sbjct: 119 KAYSRRITARKELGKLKEAMDDAEFAVSIDPNNPELRKQYSEIKELHMKEVANRSKPTKH 178


>tr|A9TLT3|A9TLT3_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_147477 PE=4 SV=1
Length = 387

Score = 121 bits (303), Expect = 3e-26
Identities = 69/124 (55%), Positives = 81/124 (65%), Gaps = 26/124 (20%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRR----------------FQEAEVDCTEALAL 415
AIECYSRSI L+P+AV++ANRAMA +KIRR + +AE DCTEA++L
Sbjct: 32 AIECYSRSIALEPTAVTFANRAMAFLKIRRTVLSSSWLLISDLYTRYADAEADCTEAISL 91

Query: 414 DDRYIKAYSRRATARKELGNLLGA----------VADSEFALRLEPDNKELKEQYINAKA 265
DDRY KAYSRR TARKEL A AD EFALRLEP+NKELK+QY AK
Sbjct: 92 DDRYTKAYSRRGTARKELQKYFPAGMDLDMKRFTFADFEFALRLEPENKELKKQYNEAKG 151

Query: 264 MCEK 253
+ EK
Sbjct: 152 LYEK 155


>tr|Q688Q3|Q688Q3_ORYSJ Unknow protein (Putative uncharacterized
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0056I11.17 PE=4 SV=1
Length = 442

Score = 106 bits (265), Expect = 7e-22
Identities = 66/154 (42%), Positives = 84/154 (54%), Gaps = 45/154 (29%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRR------------------FQEAEVDCTEAL 421
AIECYSRSI L PSAV++ANRAMA +K+RR F+EAE DCTEAL
Sbjct: 59 AIECYSRSIGLSPSAVAFANRAMAYLKLRRQILKNLSWISILEPLFNKFEEAENDCTEAL 118

Query: 420 ALDDRYIKAYSRRATARKELGNLLGAV---------------------------ADSEFA 322
LDDRY+KAYSRR TARKELG L A+ D+EFA
Sbjct: 119 NLDDRYVKAYSRRITARKELGKLKEAMDGILFLATSLSFFSLIVVLMNTDKQVHTDAEFA 178

Query: 321 LRLEPDNKELKEQYINAKAMCEKMMNMKPEEKAH 220
+ ++P+N EL++QY K + K + + + H
Sbjct: 179 VSIDPNNPELRKQYSEIKELHMKEVANRSKPTKH 212


>tr|A7PRR0|A7PRR0_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022599001
PE=4 SV=1
Length = 348

Score = 100 bits (250), Expect = 4e-20
Identities = 56/104 (53%), Positives = 69/104 (66%)
Frame = -1

Query: 546 AIECYSRSIVLQPSAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATARK 367
AI+CYSRSI L P+AV+YANRAMA IKI+R + AYSRRATARK
Sbjct: 145 AIDCYSRSIALLPTAVAYANRAMAYIKIKR--------------QKLKMTAYSRRATARK 190

Query: 366 ELGNLLGAVADSEFALRLEPDNKELKEQYINAKAMCEKMMNMKP 235
ELG A D+EFALRLEP N+E+K+QY AK++ EK + + P
Sbjct: 191 ELGKFKEATEDAEFALRLEPQNQEIKKQYAEAKSLYEKKLILLP 234


>tr|A4S4X9|A4S4X9_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_17396 PE=4 SV=1
Length = 576

Score = 86.3 bits (212), Expect = 1e-15
Identities = 49/94 (52%), Positives = 60/94 (63%), Gaps = 1/94 (1%)
Frame = -1

Query: 546 AIECYSRSIVLQP-SAVSYANRAMACIKIRRFQEAEVDCTEALALDDRYIKAYSRRATAR 370
AIE YS +I P S + ANRAMA +K+ +Q AE DCTEA+ LD RY+KAY RRA AR
Sbjct: 468 AIEYYSVAIGKNPKSKIFVANRAMAHLKLGNYQLAEDDCTEAIKLDARYVKAYLRRAAAR 527

Query: 369 KELGNLLGAVADSEFALRLEPDNKELKEQYINAK 268
GN L A+ D E ALR EP+N + K + K
Sbjct: 528 SVAGNYLEALMDYEEALRFEPNNSDAKREVYRMK 561