BP921660
Clone id YMU001_000152_F08
Library
Length 514
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_F08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAATTTCCGGCTGGGAAGTGGATATTTCGAAGCTCAGAAGCTATAGAGATCTGCCATCA
GCTGCCAAGAGGTACATTGACAGGGTTGAAAGCTTAGTGGGCATACCTGTGCGTTTTATT
GGTGTTGGCCCCGGTCGGGATGCAATGATCATCAAAGATTGAGTGGTGTGTGCTATGTTG
GAAGCCCTCAATTTACAAGTTCTCATTACCACATCTGAGGTCAGATACAATAAGAGTCTC
ATTACCTTCTCTTGTCTCTTGCTCTTTTGCCAATTTTTAACCAACAATAGGGAGGCGAAG
TGATGTTGTCGTGAAAAATTCTGATGGTATGATTTTTTGGAATGATCCTCTAGCAAATTA
AGAGGCTTCTTGACGTGTAACTGGTATTTTGGAAGAGGCTAAGCAGTATGGAAAATATGT
CAGTTGGTTTGAGAGCTCATGCTATCCAAAATTGGGGCTTTAACATTATTATAGATCAAG
AATAAATGCCATTTAACAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id O24396
Definition sp|O24396|PURA_WHEAT Adenylosuccinate synthetase, chloroplastic (Fragment) OS=Triticum aestivum
Align length 51
Score (bit) 76.3
E-value 7.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921660|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_F08.
(494 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O24396|PURA_WHEAT Adenylosuccinate synthetase, chloroplastic ... 76 7e-14
sp|Q96529|PURA_ARATH Adenylosuccinate synthetase, chloroplastic ... 75 2e-13
sp|O24578|PURA_MAIZE Adenylosuccinate synthetase, chloroplastic ... 73 8e-13
sp|A6TXB3|PURA_ALKMQ Adenylosuccinate synthetase OS=Alkaliphilus... 66 8e-11
sp|Q0RBA3|PURA_FRAAA Adenylosuccinate synthetase OS=Frankia alni... 63 8e-10
sp|P80210|PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyce... 62 2e-09
sp|Q02787|PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccha... 60 7e-09
sp|Q8TPJ2|PURA1_METAC Adenylosuccinate synthetase 1 OS=Methanosa... 60 7e-09
sp|Q8EVI1|PURA_MYCPE Adenylosuccinate synthetase OS=Mycoplasma p... 59 9e-09
sp|Q2J4S8|PURA_FRASC Adenylosuccinate synthetase OS=Frankia sp. ... 59 9e-09
sp|A0LWT8|PURA_ACIC1 Adenylosuccinate synthetase OS=Acidothermus... 59 1e-08
sp|A3DK09|PURA_CLOTH Adenylosuccinate synthetase OS=Clostridium ... 59 2e-08
sp|A0PS01|PURA_MYCUA Adenylosuccinate synthetase OS=Mycobacteriu... 58 3e-08
sp|P65880|PURA_MYCTU Adenylosuccinate synthetase OS=Mycobacteriu... 57 4e-08
sp|A5TZ84|PURA_MYCTA Adenylosuccinate synthetase OS=Mycobacteriu... 57 4e-08
sp|A1KFH8|PURA_MYCBP Adenylosuccinate synthetase OS=Mycobacteriu... 57 4e-08
sp|P65881|PURA_MYCBO Adenylosuccinate synthetase OS=Mycobacteriu... 57 4e-08
sp|Q2RG43|PURA_MOOTA Adenylosuccinate synthetase OS=Moorella the... 57 4e-08
sp|Q8TIM8|PURA2_METAC Adenylosuccinate synthetase 2 OS=Methanosa... 57 4e-08
sp|Q2LSI8|PURA_SYNAS Adenylosuccinate synthetase OS=Syntrophus a... 57 5e-08
sp|A0QQH7|PURA_MYCS2 Adenylosuccinate synthetase OS=Mycobacteriu... 57 5e-08
sp|O69595|PURA_MYCLE Adenylosuccinate synthetase OS=Mycobacteriu... 57 6e-08
sp|A5GC19|PURA_GEOUR Adenylosuccinate synthetase OS=Geobacter ur... 56 1e-07
sp|Q3IIQ6|PURA2_PSEHT Adenylosuccinate synthetase 2 OS=Pseudoalt... 56 1e-07
sp|A4FQK6|PURA_SACEN Adenylosuccinate synthetase OS=Saccharopoly... 55 1e-07
sp|A1T2W5|PURA_MYCVP Adenylosuccinate synthetase OS=Mycobacteriu... 55 1e-07
sp|Q1BEP8|PURA_MYCSS Adenylosuccinate synthetase OS=Mycobacteriu... 55 1e-07
sp|A1UA84|PURA_MYCSK Adenylosuccinate synthetase OS=Mycobacteriu... 55 1e-07
sp|A3PTT9|PURA_MYCSJ Adenylosuccinate synthetase OS=Mycobacteriu... 55 1e-07
sp|A4T142|PURA_MYCGI Adenylosuccinate synthetase OS=Mycobacteriu... 55 1e-07

>sp|O24396|PURA_WHEAT Adenylosuccinate synthetase, chloroplastic
(Fragment) OS=Triticum aestivum PE=1 SV=1
Length = 476

Score = 76.3 bits (186), Expect = 7e-14
Identities = 31/51 (60%), Positives = 42/51 (82%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +RSY +LP AA+RY++R+E L G+PV +IGVGPGRDA+I K
Sbjct: 426 LPGWDSDISSVRSYSELPQAARRYVERIEELAGVPVHYIGVGPGRDALIYK 476


>sp|Q96529|PURA_ARATH Adenylosuccinate synthetase, chloroplastic
OS=Arabidopsis thaliana GN=At3g57610 PE=1 SV=1
Length = 490

Score = 75.1 bits (183), Expect = 2e-13
Identities = 29/51 (56%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +R+Y DLP AA++Y++R+E LVG+P+ +IG+GPGRDA+I K
Sbjct: 440 LPGWKSDISSVRNYSDLPKAAQQYVERIEELVGVPIHYIGIGPGRDALIYK 490


>sp|O24578|PURA_MAIZE Adenylosuccinate synthetase, chloroplastic
OS=Zea mays PE=2 SV=1
Length = 484

Score = 72.8 bits (177), Expect = 8e-13
Identities = 30/51 (58%), Positives = 41/51 (80%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +R Y +LP AA+ Y++R+E LVG+PV +IGVGPGRDA+I K
Sbjct: 434 LPGWQSDISSVRRYDELPQAARLYVERIEELVGVPVHYIGVGPGRDALIYK 484


>sp|A6TXB3|PURA_ALKMQ Adenylosuccinate synthetase OS=Alkaliphilus
metalliredigens (strain QYMF) GN=purA PE=3 SV=1
Length = 427

Score = 66.2 bits (160), Expect = 8e-11
Identities = 26/53 (49%), Positives = 41/53 (77%)
Frame = +1

Query: 1 EISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIKD 159
E+ GWE DI+ +++Y +LP AK+YI+R+ES VG+P++ I VGP R+ II++
Sbjct: 372 ELPGWEEDITNMKTYEELPENAKKYIERIESYVGVPIKMISVGPKRNQTIIRE 424


>sp|Q0RBA3|PURA_FRAAA Adenylosuccinate synthetase OS=Frankia alni
(strain ACN14a) GN=purA PE=3 SV=1
Length = 427

Score = 62.8 bits (151), Expect = 8e-10
Identities = 28/51 (54%), Positives = 36/51 (70%)
Frame = +1

Query: 1 EISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMII 153
E+ GW+ D+S +R Y DLP+AAK YI +E L G PV IGVGPGRD ++
Sbjct: 372 ELPGWQEDLSDVRKYADLPAAAKDYIRTLEELSGAPVSAIGVGPGRDQTLV 422


>sp|P80210|PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces
cerevisiae GN=ADE12 PE=1 SV=3
Length = 433

Score = 61.6 bits (148), Expect = 2e-09
Identities = 23/52 (44%), Positives = 37/52 (71%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIKD 159
+ GW+ DI+K+ Y DLP AK+Y+ +E VG+PV ++G GP R++M+ K+
Sbjct: 380 LPGWDQDITKITKYEDLPENAKKYLKYIEDFVGVPVEWVGTGPARESMLHKE 431


>sp|Q02787|PURA_SCHPO Adenylosuccinate synthetase
OS=Schizosaccharomyces pombe GN=ade2 PE=2 SV=2
Length = 434

Score = 59.7 bits (143), Expect = 7e-09
Identities = 23/50 (46%), Positives = 36/50 (72%)
Frame = +1

Query: 10 GWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIKD 159
GW+V + + + +P AK+YI+ +E VG+P+ FIGVGPGRD M++K+
Sbjct: 385 GWKVPTTGITHWDQMPENAKKYIEFIEKFVGVPITFIGVGPGRDEMLVKE 434


>sp|Q8TPJ2|PURA1_METAC Adenylosuccinate synthetase 1
OS=Methanosarcina acetivorans GN=purA1 PE=3 SV=1
Length = 424

Score = 59.7 bits (143), Expect = 7e-09
Identities = 26/51 (50%), Positives = 35/51 (68%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GWE + S+ DLP AK YI R+E LVG+PV++IGVGP R +II+
Sbjct: 374 LPGWECTTRGVNSFDDLPENAKSYIKRIEELVGVPVKYIGVGPARSDVIIR 424


>sp|Q8EVI1|PURA_MYCPE Adenylosuccinate synthetase OS=Mycoplasma
penetrans GN=purA PE=3 SV=2
Length = 426

Score = 59.3 bits (142), Expect = 9e-09
Identities = 25/52 (48%), Positives = 36/52 (69%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIKD 159
+ GW D+S+++SY DLP KRYI +E+ + + VRF+ VGP R+ IIKD
Sbjct: 374 LDGWSEDVSRIKSYDDLPLNLKRYISYIENFLKVRVRFVSVGPDRNQTIIKD 425


>sp|Q2J4S8|PURA_FRASC Adenylosuccinate synthetase OS=Frankia sp.
(strain CcI3) GN=purA PE=3 SV=1
Length = 427

Score = 59.3 bits (142), Expect = 9e-09
Identities = 26/51 (50%), Positives = 34/51 (66%)
Frame = +1

Query: 1 EISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMII 153
++ GW DIS +RS+ DLP AAK YI +E G PV +GVGPGRD ++
Sbjct: 372 DLPGWHEDISDVRSFADLPGAAKDYIRALEEFSGAPVSAVGVGPGRDQTLV 422


tr_hit_id B4FDL8
Definition tr|B4FDL8|B4FDL8_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 51
Score (bit) 78.2
E-value 2.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921660|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_F08.
(494 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4FDL8|B4FDL8_MAIZE Putative uncharacterized protein OS=Zea m... 78 2e-13
tr|A9TIK2|A9TIK2_PHYPA Adenylosuccinate synthetase OS=Physcomitr... 77 3e-13
tr|Q10R17|Q10R17_ORYSJ Adenylosuccinate synthetase OS=Oryza sati... 77 6e-13
tr|A3AEN4|A3AEN4_ORYSJ Adenylosuccinate synthetase OS=Oryza sati... 77 6e-13
tr|A2XD35|A2XD35_ORYSI Adenylosuccinate synthetase OS=Oryza sati... 77 6e-13
tr|Q6T7E8|Q6T7E8_TOBAC Adenylosuccinate synthetase OS=Nicotiana ... 75 1e-12
tr|Q8LEZ6|Q8LEZ6_ARATH Adenylosuccinate synthetase OS=Arabidopsi... 75 2e-12
tr|Q851S8|Q851S8_ORYSJ Adenylosuccinate synthetase OS=Oryza sati... 75 2e-12
tr|Q570J3|Q570J3_ARATH Adenylosuccinate synthetase (Fragment) OS... 75 2e-12
tr|Q10EJ8|Q10EJ8_ORYSJ Adenylosuccinate synthetase OS=Oryza sati... 75 2e-12
tr|B8AQ03|B8AQ03_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A3ALR6|A3ALR6_ORYSJ Adenylosuccinate synthetase OS=Oryza sati... 75 2e-12
tr|A9XLG1|A9XLG1_SOLBU Adenylosuccinate synthetase OS=Solanum bu... 75 2e-12
tr|A9XLE1|A9XLE1_CAPFR Adenylosuccinate synthetase OS=Capsicum f... 74 3e-12
tr|A9SCV9|A9SCV9_PHYPA Adenylosuccinate synthetase OS=Physcomitr... 73 6e-12
tr|B4FTW9|B4FTW9_MAIZE Putative uncharacterized protein OS=Zea m... 73 8e-12
tr|A6XGV9|A6XGV9_9CHLO Adenylosuccinate synthetase (Fragment) OS... 73 8e-12
tr|A7PWB8|A7PWB8_VITVI Adenylosuccinate synthetase OS=Vitis vini... 72 1e-11
tr|A5B050|A5B050_VITVI Adenylosuccinate synthetase OS=Vitis vini... 72 1e-11
tr|A9XLE2|A9XLE2_CAPFR Adenylosuccinate synthetase OS=Capsicum f... 72 1e-11
tr|Q017T9|Q017T9_OSTTA Adenylosuccinate synthetase OS=Ostreococc... 71 2e-11
tr|A8IW34|A8IW34_CHLRE Adenylosuccinate synthetase OS=Chlamydomo... 71 2e-11
tr|A6D1U3|A6D1U3_9VIBR Adenylosuccinate synthetase OS=Vibrio shi... 67 5e-10
tr|A4RYD2|A4RYD2_OSTLU Adenylosuccinate synthetase OS=Ostreococc... 67 5e-10
tr|Q6BUG5|Q6BUG5_DEBHA Adenylosuccinate synthetase OS=Debaryomyc... 66 1e-09
tr|A5DSZ3|A5DSZ3_LODEL Adenylosuccinate synthetase OS=Lodderomyc... 63 9e-09
tr|Q6CQ65|Q6CQ65_KLULA Adenylosuccinate synthetase OS=Kluyveromy... 62 1e-08
tr|B8FB83|B8FB83_9DELT Adenylosuccinate synthase OS=Desulfatibac... 62 1e-08
tr|A9UTP3|A9UTP3_MONBE Adenylosuccinate synthetase OS=Monosiga b... 62 1e-08
tr|Q75E56|Q75E56_ASHGO Adenylosuccinate synthetase OS=Ashbya gos... 62 1e-08

>tr|B4FDL8|B4FDL8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 271

Score = 78.2 bits (191), Expect = 2e-13
Identities = 33/51 (64%), Positives = 41/51 (80%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GWE DIS +R Y DLP A+RY++R+E LVGIPV +IGVGPGRDA+I K
Sbjct: 221 LPGWEEDISSIRDYSDLPETARRYVERIEELVGIPVHYIGVGPGRDALIYK 271


>tr|A9TIK2|A9TIK2_PHYPA Adenylosuccinate synthetase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_222623 PE=3 SV=1
Length = 514

Score = 77.4 bits (189), Expect = 3e-13
Identities = 30/51 (58%), Positives = 46/51 (90%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DI+K+RSY +LP+AA+RY++R+E L+G+P ++IGVGPGRDA+I+K
Sbjct: 463 LEGWKEDITKVRSYDELPAAAQRYVERIEELIGLPCQYIGVGPGRDALIVK 513


>tr|Q10R17|Q10R17_ORYSJ Adenylosuccinate synthetase OS=Oryza sativa
subsp. japonica GN=Os03g0174500 PE=2 SV=1
Length = 488

Score = 76.6 bits (187), Expect = 6e-13
Identities = 32/51 (62%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +RSY +LP AA+RY++R+E LVG+PV +IGVGPGRDA+I K
Sbjct: 438 LPGWQSDISSVRSYSELPLAAQRYVERIEELVGVPVHYIGVGPGRDALIYK 488


>tr|A3AEN4|A3AEN4_ORYSJ Adenylosuccinate synthetase OS=Oryza sativa
subsp. japonica GN=OsJ_009256 PE=3 SV=1
Length = 507

Score = 76.6 bits (187), Expect = 6e-13
Identities = 32/51 (62%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +RSY +LP AA+RY++R+E LVG+PV +IGVGPGRDA+I K
Sbjct: 457 LPGWQSDISSVRSYSELPLAAQRYVERIEELVGVPVHYIGVGPGRDALIYK 507


>tr|A2XD35|A2XD35_ORYSI Adenylosuccinate synthetase OS=Oryza sativa
subsp. indica GN=OsI_10220 PE=3 SV=1
Length = 506

Score = 76.6 bits (187), Expect = 6e-13
Identities = 32/51 (62%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +RSY +LP AA+RY++R+E LVG+PV +IGVGPGRDA+I K
Sbjct: 456 LPGWQSDISSVRSYSELPLAAQRYVERIEDLVGVPVHYIGVGPGRDALIYK 506


>tr|Q6T7E8|Q6T7E8_TOBAC Adenylosuccinate synthetase OS=Nicotiana
tabacum GN=purA PE=2 SV=1
Length = 505

Score = 75.5 bits (184), Expect = 1e-12
Identities = 31/49 (63%), Positives = 40/49 (81%)
Frame = +1

Query: 10 GWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
GW+ DIS +R Y DLP AA+ Y++R+E LVG+PV +IGVGPGRDA+I K
Sbjct: 457 GWQSDISSVRKYSDLPKAAREYVERIEELVGVPVHYIGVGPGRDALIYK 505


>tr|Q8LEZ6|Q8LEZ6_ARATH Adenylosuccinate synthetase OS=Arabidopsis
thaliana PE=2 SV=1
Length = 490

Score = 75.1 bits (183), Expect = 2e-12
Identities = 29/51 (56%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +R+Y DLP AA++Y++R+E LVG+P+ +IG+GPGRDA+I K
Sbjct: 440 LPGWKSDISSVRNYSDLPKAAQQYVERIEELVGVPIHYIGIGPGRDALIYK 490


>tr|Q851S8|Q851S8_ORYSJ Adenylosuccinate synthetase OS=Oryza sativa
subsp. japonica GN=OSJNBb0017F17.14 PE=2 SV=1
Length = 489

Score = 75.1 bits (183), Expect = 2e-12
Identities = 32/51 (62%), Positives = 41/51 (80%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GWE DIS +R+Y DLP A+ Y++R+E LVGIPV +IGVGPGRDA+I K
Sbjct: 439 LPGWEDDISSVRNYSDLPETARLYVERIEELVGIPVHYIGVGPGRDALIYK 489


>tr|Q570J3|Q570J3_ARATH Adenylosuccinate synthetase (Fragment)
OS=Arabidopsis thaliana GN=At3g57610 PE=2 SV=1
Length = 161

Score = 75.1 bits (183), Expect = 2e-12
Identities = 29/51 (56%), Positives = 43/51 (84%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GW+ DIS +R+Y DLP AA++Y++R+E LVG+P+ +IG+GPGRDA+I K
Sbjct: 111 LPGWKSDISSVRNYSDLPKAAQQYVERIEELVGVPIHYIGIGPGRDALIYK 161


>tr|Q10EJ8|Q10EJ8_ORYSJ Adenylosuccinate synthetase OS=Oryza sativa
subsp. japonica GN=LOC_Os03g49220 PE=3 SV=1
Length = 472

Score = 75.1 bits (183), Expect = 2e-12
Identities = 32/51 (62%), Positives = 41/51 (80%)
Frame = +1

Query: 4 ISGWEVDISKLRSYRDLPSAAKRYIDRVESLVGIPVRFIGVGPGRDAMIIK 156
+ GWE DIS +R+Y DLP A+ Y++R+E LVGIPV +IGVGPGRDA+I K
Sbjct: 422 LPGWEDDISSVRNYSDLPETARLYVERIEELVGIPVHYIGVGPGRDALIYK 472