BP921663
Clone id YMU001_000152_F11
Library
Length 608
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAACACGTGAGCGCATCTGTAACTGCTCTAGTGTAGATGCAACATGCATACCACTAGGG
CTAGAGCTACGATGACACTCCTGATGCAGGTATCGAGTGATGACATGCATGGCTCGACAA
TGCACAATGCCAGTGTCAGTCATCACATGACTGACAACCCCCACTACAAATGCACAAACT
GCATAAGCAAGATCGGGTCTCAAGACCAAAAGGTCAGACATGAGAGATCCAAAAGCTGAC
ACCAATCTATTTCTGTCAGCAACCTCAATGTCATATGCATCCTCATAAGGAACCACCTGA
CTATGCATCACCATGTCAGCATCGTCTGGCAAAGGCATATTTGCTGAGAATGACTGCAAA
ACCAAAAAATCAGCACCACTGCAATCACACACAGTTGTATAAAGGACACTATCACCTTCA
AACGTATCAAACACATCATAGAACAATGCTCTGGCTCAACTGATGTCACCTCATTTGATG
ACTGACCAAGCTGTGCATCCCCAGAGACACCACTGTGTGCGTGAACGTCACCACAAGAAA
AATGCACAACCTGATCTCCATGCAACACAACCACAAAAGAGACATGCCTCGTCTCTCGCT
CCAAATAT
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 51
Score (bit) 37.7
E-value 0.046
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921663|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_F11.
(608 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 38 0.046
sp|Q02930|CREB5_HUMAN cAMP-responsive element-binding protein 5 ... 35 0.23
sp|Q9V7N5|VATC_DROME V-type proton ATPase subunit C OS=Drosophil... 35 0.30
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogas... 35 0.39
sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5 ... 35 0.39
sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium l... 28 1.3
sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyc... 33 1.5
sp|P32290|CATA_PHAAU Catalase OS=Phaseolus aureus PE=2 SV=1 33 1.5
sp|Q62563|SRY_MUSSP Sex-determining region Y protein OS=Mus spre... 27 1.6
sp|P36417|GBF_DICDI G-box-binding factor OS=Dictyostelium discoi... 25 2.6
sp|Q8R2V3|ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus GN... 31 4.3
sp|Q05738|SRY_MOUSE Sex-determining region Y protein OS=Mus musc... 25 4.4
sp|A4GYV4|YCF2_POPTR Protein ycf2 OS=Populus trichocarpa GN=ycf2... 31 5.6
sp|Q14F97|YCF2_POPAL Protein ycf2 OS=Populus alba GN=ycf2-A PE=3... 31 5.6
sp|Q2L949|YCF2_GOSHI Protein ycf2 OS=Gossypium hirsutum GN=ycf2-... 31 5.6
sp|A0ZZ78|YCF2_GOSBA Protein ycf2 OS=Gossypium barbadense GN=ycf... 31 5.6
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS... 30 7.4
sp|P19811|RPOA_EAVBU Replicase polyprotein 1ab OS=Equine arterit... 30 9.6
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=M... 30 9.6

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 37.7 bits (86), Expect = 0.046
Identities = 23/51 (45%), Positives = 30/51 (58%)
Frame = -1

Query: 239 SAFGSLMSDLLVLRPDLAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
SA GSLM ++ RPD+A+A VGVVS + + G H A+ I RYL
Sbjct: 1113 SAVGSLMYAMVCTRPDIAHA-----VGVVSRFLENPGKEHWEAVKWILRYL 1158


>sp|Q02930|CREB5_HUMAN cAMP-responsive element-binding protein 5
OS=Homo sapiens GN=CREB5 PE=1 SV=2
Length = 508

Score = 35.4 bits (80), Expect = 0.23
Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 5/68 (7%)
Frame = +2

Query: 257 QQPQCHMHPHKE-----PPDYASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQ 421
Q P HMH H PP + P QH+ + P+ H NH + H HL
Sbjct: 268 QTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH-----PHPQPHHQQNHPH-HHSHSHLH 321

Query: 422 TYQTHHRT 445
+ HH+T
Sbjct: 322 AHPAHHQT 329


>sp|Q9V7N5|VATC_DROME V-type proton ATPase subunit C OS=Drosophila
melanogaster GN=Vha44 PE=1 SV=4
Length = 714

Score = 35.0 bits (79), Expect = 0.30
Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
Frame = +2

Query: 293 PPDYASPCQHRLAKAYL-LRMTAKPKNQHHCNHTQLYKGHYH 415
PPD + PC+H +L LR K ++ HH N Q Y H+H
Sbjct: 100 PPDDSMPCRHHQRIKHLSLRHQRKHQHTHHQNKPQHYHHHHH 141


>sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster
GN=srp PE=1 SV=2
Length = 1264

Score = 34.7 bits (78), Expect = 0.39
Identities = 13/39 (33%), Positives = 24/39 (61%)
Frame = +1

Query: 466 SPHLMTDQAVHPQRHHCVRERHHKKNAQPDLHATQPQKR 582
SP+ +T + +H Q+HH ++ HH + Q L+ Q Q++
Sbjct: 397 SPYALTHEQLHQQQHHHQQQLHHHQQQQQQLYHQQQQQQ 435


>sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5
OS=Mus musculus GN=Creb5 PE=2 SV=3
Length = 357

Score = 34.7 bits (78), Expect = 0.39
Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
Frame = +2

Query: 272 HMHPHKE---PPDYASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQTYQTHHR 442
H HPH+ PP + P QH+ + P+ H NH + H HL + HH+
Sbjct: 124 HSHPHQHQTLPPHHPYPHQHQHPAHH-----PHPQPHHQQNHPH-HHSHSHLHAHPAHHQ 177

Query: 443 T 445
T
Sbjct: 178 T 178


>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium
lophurae PE=4 SV=1
Length = 351

Score = 28.5 bits (62), Expect(2) = 1.3
Identities = 15/59 (25%), Positives = 21/59 (35%)
Frame = +2

Query: 263 PQCHMHPHKEPPDYASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQTYQTHH 439
P+ H PH E + P H + HH H + GH+H + HH
Sbjct: 82 PEEHHEPHHEEHHHHHPHPHH-------------HHHHHPPHHHHHLGHHHHHHHAAHH 127



Score = 21.9 bits (45), Expect(2) = 1.3
Identities = 9/30 (30%), Positives = 11/30 (36%)
Frame = +1

Query: 496 HPQRHHCVRERHHKKNAQPDLHATQPQKRH 585
H HH E HH +A H + H
Sbjct: 123 HAAHHHHHEEHHHHHHAAHHHHHEEHHHHH 152



Score = 26.9 bits (58), Expect(2) = 9.4
Identities = 15/59 (25%), Positives = 22/59 (37%)
Frame = +2

Query: 263 PQCHMHPHKEPPDYASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQTYQTHH 439
P H H H P + H A + P + HH +H + H+H + HH
Sbjct: 174 PHHHHHHHHAPHHHH---HHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHH 229



Score = 20.4 bits (41), Expect(2) = 9.4
Identities = 7/22 (31%), Positives = 9/22 (40%)
Frame = +1

Query: 496 HPQRHHCVRERHHKKNAQPDLH 561
H HH + HH + D H
Sbjct: 244 HHHHHHHHHDAHHHHHHHHDAH 265


>sp|Q10199|IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces
pombe GN=imp2 PE=1 SV=1
Length = 670

Score = 32.7 bits (73), Expect = 1.5
Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
Frame = +3

Query: 375 TTAITHSCIKDTITFKRIKHIIEQCSGSTDVTSFDD*PSCAS--PETP 512
T I+ SC D +RI+ +EQCS S DV F D S + P+ P
Sbjct: 240 TLLISRSCFNDDQACERIRKNLEQCSVSQDVLEFIDAKSTGTGIPQPP 287


>sp|P32290|CATA_PHAAU Catalase OS=Phaseolus aureus PE=2 SV=1
Length = 492

Score = 32.7 bits (73), Expect = 1.5
Identities = 15/38 (39%), Positives = 19/38 (50%)
Frame = +2

Query: 302 YASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYH 415
YA +HRL YLL PK+ HH NH + + H
Sbjct: 348 YADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIH 385


>sp|Q62563|SRY_MUSSP Sex-determining region Y protein OS=Mus spretus
GN=Sry PE=3 SV=2
Length = 355

Score = 27.3 bits (59), Expect(2) = 1.6
Identities = 25/103 (24%), Positives = 37/103 (35%)
Frame = +2

Query: 131 QCQSSHD*QPPLQMHKLHKQDRVSRPKGQT*EIQKLTPIYFCQQPQCHMHPHKEPPDYAS 310
Q Q HD Q Q H+Q + Q + Q + QQ Q H H H +
Sbjct: 176 QQQQFHDHQQQQQQFHDHQQQKQQFHDHQQQQQQFHDHHHQQQQQQFHDHHHHQQQQQQF 235

Query: 311 PCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQTYQTHH 439
H+ + + + + Q H + Q + H H Q Q H
Sbjct: 236 HDHHQQKQQFHDHHQQQQQQQFHDHPQQQQQFHDHPQQKQQFH 278



Score = 22.7 bits (47), Expect(2) = 1.6
Identities = 8/29 (27%), Positives = 13/29 (44%)
Frame = +1

Query: 496 HPQRHHCVRERHHKKNAQPDLHATQPQKR 582
HPQ+ + HH + + H QK+
Sbjct: 270 HPQQKQQFHDHHHHQQQKQQFHDHHQQKQ 298


>sp|P36417|GBF_DICDI G-box-binding factor OS=Dictyostelium
discoideum GN=gbfA PE=1 SV=2
Length = 708

Score = 25.4 bits (54), Expect(2) = 2.6
Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 2/35 (5%)
Frame = +1

Query: 487 QAVHPQRHHCVRERHHKKNAQPDLH--ATQPQKRH 585
Q H Q+HH +++ +++ Q H +QPQ++H
Sbjct: 199 QQQHQQQHHQQQQQQQQQHHQQQQHHQHSQPQQQH 233



Score = 23.9 bits (50), Expect(2) = 2.6
Identities = 12/53 (22%), Positives = 20/53 (37%)
Frame = +2

Query: 290 EPPDYASPCQHRLAKAYLLRMTAKPKNQHHCNHTQLYKGHYHLQTYQTHHRTM 448
+PP QH + + + + Q H Q + H+ Q HH+ M
Sbjct: 129 QPPQQNQQQQHHQQQQQQPQHHQQMQQQQHHQQMQQQQQHHQQMQQQQHHQQM 181


tr_hit_id Q53ND1
Definition tr|Q53ND1|Q53ND1_ORYSJ Os11g0157000 protein OS=Oryza sativa subsp. japonica
Align length 96
Score (bit) 46.2
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921663|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_F11.
(608 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q53ND1|Q53ND1_ORYSJ Os11g0157000 protein OS=Oryza sativa subs... 46 0.001
tr|Q01MI4|Q01MI4_ORYSA H0515C11.7 protein OS=Oryza sativa GN=H05... 46 0.002
tr|Q6L4V3|Q6L4V3_ORYSJ Putative polyprotein OS=Oryza sativa subs... 45 0.003
tr|Q2RAY7|Q2RAY7_ORYSJ Retrotransposon protein, putative, Ty1-co... 45 0.003
tr|A5B5Y8|A5B5Y8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.004
tr|A5B6M5|A5B6M5_VITVI Putative uncharacterized protein OS=Vitis... 44 0.006
tr|Q7XTM9|Q7XTM9_ORYSJ OSJNBa0033G05.13 protein OS=Oryza sativa ... 44 0.007
tr|B8YLY7|B8YLY7_LOTJA Gag-Pol polyprotein OS=Lotus japonicus PE... 44 0.010
tr|Q55IK1|Q55IK1_CRYNE Putative uncharacterized protein OS=Crypt... 43 0.012
tr|Q0J4E9|Q0J4E9_ORYSJ Os08g0518300 protein OS=Oryza sativa subs... 43 0.016
tr|B8YLY6|B8YLY6_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 43 0.016
tr|B8YLY5|B8YLY5_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 43 0.016
tr|B8YLY4|B8YLY4_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 43 0.016
tr|B8YLY3|B8YLY3_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 43 0.016
tr|Q9SHR5|Q9SHR5_ARATH F28L22.3 protein OS=Arabidopsis thaliana ... 42 0.021
tr|Q6AUC7|Q6AUC7_ORYSJ Putative polyprotein OS=Oryza sativa subs... 42 0.021
tr|Q2QSQ2|Q2QSQ2_ORYSJ Retrotransposon protein, putative, Ty1-co... 42 0.021
tr|Q02902|Q02902_ARATH Orf 3 (Fragment) OS=Arabidopsis thaliana ... 42 0.021
tr|A5BD56|A5BD56_VITVI Putative uncharacterized protein OS=Vitis... 42 0.021
tr|A5AMT8|A5AMT8_VITVI Putative uncharacterized protein OS=Vitis... 42 0.028
tr|Q01M93|Q01M93_ORYSA OSIGBa0146N20.7 protein OS=Oryza sativa G... 42 0.036
tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5CA02|A5CA02_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5C844|A5C844_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5BJQ3|A5BJQ3_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5BIC7|A5BIC7_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5BGX3|A5BGX3_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis... 42 0.036
tr|Q0E1G5|Q0E1G5_ORYSJ Os02g0450400 protein OS=Oryza sativa subs... 41 0.047

>tr|Q53ND1|Q53ND1_ORYSJ Os11g0157000 protein OS=Oryza sativa subsp.
japonica GN=Os11g0157000 PE=4 SV=1
Length = 2340

Score = 46.2 bits (108), Expect = 0.001
Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMH----SQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRP 195
VL+ F+ + P + H S + P D YDIE R SA GSLM ++ RP
Sbjct: 1281 VLRRFNMHDAKPVSTPLAAHFRLSSDLCPQSD-YDIEYMSRVPYSSAVGSLMYAMVCSRP 1339

Query: 194 DLAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
DL++A + VVS M + G H +A+ I RYL
Sbjct: 1340 DLSHA-----LSVVSRYMANPGKEHWKAVQWIFRYL 1370


>tr|Q01MI4|Q01MI4_ORYSA H0515C11.7 protein OS=Oryza sativa
GN=H0515C11.7 PE=4 SV=1
Length = 293

Score = 45.8 bits (107), Expect = 0.002
Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 3/95 (3%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMHSQVVPYEDAY---DIEVADRNRLVSAFGSLMSDLLVLRPD 192
VLQ F+ + P + H ++ + A D+E R SA GSLM ++ RPD
Sbjct: 35 VLQRFNMHDAKPVSTSIAPHFKLSALQCASTDEDVEYMSRVPYSSAVGSLMYAMVCSRPD 94

Query: 191 LAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
L++A + +VS MT+ G H +A+H I RYL
Sbjct: 95 LSHA-----MSLVSRYMTNPGKEHWKAIHWIFRYL 124


>tr|Q6L4V3|Q6L4V3_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=P0010D04.5 PE=4 SV=1
Length = 1243

Score = 45.4 bits (106), Expect = 0.003
Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMH----SQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRP 195
VL+ F+ + P + H S + P D YDIE R SA GSLM ++ RP
Sbjct: 1046 VLRRFNMHDAKPVSTPLAAHFRLSSDLCPLSD-YDIEYMSRVPYSSAVGSLMYAMVCCRP 1104

Query: 194 DLAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
DL++A + VV+ M + G H +A+ I RYL
Sbjct: 1105 DLSHA-----LSVVNRYMANPGKEHWKAVQWIFRYL 1135


>tr|Q2RAY7|Q2RAY7_ORYSJ Retrotransposon protein, putative, Ty1-copia
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g03830 PE=4 SV=1
Length = 1138

Score = 45.1 bits (105), Expect = 0.003
Identities = 37/105 (35%), Positives = 51/105 (48%), Gaps = 4/105 (3%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMH----SQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRP 195
VL+ F+ + P + H S + P D YDIE R S GSLM ++ RP
Sbjct: 880 VLRRFNMHDAKPVSTPLAAHFRLSSDLCPQSD-YDIEYMSRVPYSSVVGSLMYAMVCSRP 938

Query: 194 DLAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYLHQECHRSSS 60
DL++A + VVS M + G H +A+ I RYL C SS+
Sbjct: 939 DLSHA-----LSVVSRYMANPGKEHWKAVQWIFRYL---CGTSSA 975


>tr|A5B5Y8|A5B5Y8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035564 PE=4 SV=1
Length = 809

Score = 44.7 bits (104), Expect = 0.004
Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 3/95 (3%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMHSQVVP-YEDAYDIEVADRNRL--VSAFGSLMSDLLVLRPD 192
VL+ F+ + ++ + H ++ + + D E D R+ SA GSLM+ ++ RPD
Sbjct: 548 VLERFNMSKAKVVNSPLASHFKLSRRHSPSIDKEKEDMRRVPYASAVGSLMNPMVCTRPD 607

Query: 191 LAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
+AY V+GVVS +++ G +H A+ I RYL
Sbjct: 608 IAY-----VIGVVSRFLSNPGRLHWEAVKWIMRYL 637


>tr|A5B6M5|A5B6M5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035792 PE=4 SV=1
Length = 1179

Score = 44.3 bits (103), Expect = 0.006
Identities = 34/95 (35%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMHSQVVPYEDAYDIEVADRNRLV---SAFGSLMSDLLVLRPD 192
VL F+ N P + H ++ + E D V SA GSLM D++ RPD
Sbjct: 993 VLSRFNMNEAKPVSTPLGSHFKLSKEQSPKTEEERDHMSKVPYASAIGSLMYDMVCTRPD 1052

Query: 191 LAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
+A+A VGVVS M+ G H A+ I RYL
Sbjct: 1053 IAHA-----VGVVSRFMSRPGKQHWEAVKWILRYL 1082


>tr|Q7XTM9|Q7XTM9_ORYSJ OSJNBa0033G05.13 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0033G05.13 PE=4 SV=2
Length = 1181

Score = 43.9 bits (102), Expect = 0.007
Identities = 31/82 (37%), Positives = 42/82 (51%)
Frame = -1

Query: 329 PDDADMVMHSQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRPDLAYAVCAFVVGVVS 150
P A + S + P D Y+IE R SA GSLM ++ RPDL++A + VVS
Sbjct: 938 PLAAHFRLSSDLCPQSD-YNIEYMSRVPYSSAVGSLMYAMICSRPDLSHA-----LSVVS 991

Query: 149 HVMTDTGIVHCRAMHVITRYLH 84
M + G H + + I RYLH
Sbjct: 992 RYMANPGKEHWKDVQWIFRYLH 1013


>tr|B8YLY7|B8YLY7_LOTJA Gag-Pol polyprotein OS=Lotus japonicus PE=4
SV=1
Length = 1305

Score = 43.5 bits (101), Expect = 0.010
Identities = 31/83 (37%), Positives = 44/83 (53%)
Frame = -1

Query: 335 PLPDDADMVMHSQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRPDLAYAVCAFVVGV 156
PLP + + S ++P +A +E++ R SA GSLM ++ RPD+A A VG
Sbjct: 1061 PLP--VNYKLSSSMIPSSEAERMEMS-RVPYASAVGSLMYAMICTRPDIAQA-----VGT 1112

Query: 155 VSHVMTDTGIVHCRAMHVITRYL 87
VS M D G H A+ I RY+
Sbjct: 1113 VSRFMADPGKEHWNAVKRILRYI 1135


>tr|Q55IK1|Q55IK1_CRYNE Putative uncharacterized protein
OS=Cryptococcus neoformans GN=CNBM0210 PE=4 SV=1
Length = 1485

Score = 43.1 bits (100), Expect = 0.012
Identities = 30/97 (30%), Positives = 47/97 (48%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMHSQVVPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRPDLAY 183
+L+ F+ + P + + ++ + P D DRNR + A GSLM +L R DL
Sbjct: 1225 ILERFNVSDLRPTKSPLPSNTLLSPRTP--DDPPCDRNRYLQALGSLMYAMLGTRGDL-- 1280

Query: 182 AVCAFVVGVVSHVMTDTGIVHCRAMHVITRYLHQECH 72
+F +G++S D +H RA+ RYLH H
Sbjct: 1281 ---SFSIGLLSRFANDPSEIHWRALLHSLRYLHHTRH 1314


>tr|Q0J4E9|Q0J4E9_ORYSJ Os08g0518300 protein OS=Oryza sativa subsp.
japonica GN=Os08g0518300 PE=4 SV=1
Length = 1755

Score = 42.7 bits (99), Expect = 0.016
Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
Frame = -1

Query: 362 VLQSFSANMPLPDDADMVMHSQV---VPYEDAYDIEVADRNRLVSAFGSLMSDLLVLRPD 192
VL+ F+ + P + H ++ + + YD+E R SA GSLM ++ RPD
Sbjct: 1425 VLRRFNMHDAKPVSTPLAAHFRLSLDLCPQSYYDVEYMSRVPYSSAVGSLMYAMVCSRPD 1484

Query: 191 LAYAVCAFVVGVVSHVMTDTGIVHCRAMHVITRYL 87
L++A + VVS M + G H +A+ I RYL
Sbjct: 1485 LSHA-----LSVVSRYMANPGKEHWKAVQWIFRYL 1514