BP921665
Clone id YMU001_000152_G02
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACAATCCTTGACCTTGACCATTTCTCAACATGTCCACTACGCCTAATCCTATTCCAACTG
CAGGTCATGATCTCCTCCTGATGGGCACCATTGCTAAAGTCAATCTAAAGGCAGCTTTAA
GTCAACAAAAGTGGCACTTCGGTATGTGTACACTCACACTACCAGAGAGGCGCATCAATA
AAGCTTTCAGCTGATCAAACTGGGAAATCTGCTCTGGGAAGATAGCATCCTGAATCTCCG
CTCAGCAAGGACACGCGAATGGCATCTGCATGTGTCTCCTCCTGATGAGCACCATTGCTA
GAATCAATCTAAAGGCAGCTTTAAGTCAACGAAAGTGGCACTTCGGTATGTGTACACTCA
CACTACCAGAGGCATATCAACAAGCTTTCAGCTGATCAAACTGGGAAATCTACTCTGGGA
AGATCGCATCCTGAATCTCCGCTCAGCAAGAACACGCGAATGGCATCTGCATGTGTCTCA
GTCAGATACATGAACCATGTTTCTCCTAACGGCCAGGAATCCTCTTCCAATATATGACCA
CACGAATC
■■Homology search results ■■ -
sp_hit_id B0C142
Definition sp|B0C142|DAPA_ACAM1 Dihydrodipicolinate synthase OS=Acaryochloris marina (strain MBIC 11017)
Align length 45
Score (bit) 31.2
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921665|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_G02.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B0C142|DAPA_ACAM1 Dihydrodipicolinate synthase OS=Acaryochlor... 31 3.4
sp|Q9UUI8|YIY4_SCHPO Uncharacterized transporter C22F8.04 OS=Sch... 31 4.5

>sp|B0C142|DAPA_ACAM1 Dihydrodipicolinate synthase OS=Acaryochloris
marina (strain MBIC 11017) GN=dapA PE=3 SV=1
Length = 294

Score = 31.2 bits (69), Expect = 3.4
Identities = 17/45 (37%), Positives = 23/45 (51%)
Frame = +3

Query: 240 AQQGHANGICMCLLLMSTIARINLKAALSQRKWHFGMCTLTLPEA 374
A + H + +C L +T I +KAAL + W G L LPEA
Sbjct: 232 ATEIHLKLLPLCKALFATTNPIPVKAALQLQGWQVGSTRLPLPEA 276


>sp|Q9UUI8|YIY4_SCHPO Uncharacterized transporter C22F8.04
OS=Schizosaccharomyces pombe GN=SPAC22F8.04 PE=2 SV=1
Length = 383

Score = 30.8 bits (68), Expect = 4.5
Identities = 17/58 (29%), Positives = 28/58 (48%)
Frame = +1

Query: 355 HSHYQRHINKLSADQTGKSTLGRSHPESPLSKNTRMASACVSVRYMNHVSPNGQESSS 528
H Q ++ + D TGKS+L S + PLSK+ + + M+ + N +E S
Sbjct: 22 HIDSQTALDSMETDSTGKSSLYFSKSDDPLSKDIEDGISTRKLEEMSVLEANAKEPDS 79


tr_hit_id B6NYK9
Definition tr|B6NYK9|B6NYK9_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae
Align length 55
Score (bit) 33.9
E-value 5.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921665|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_G02.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6NYK9|B6NYK9_BRAFL Putative uncharacterized protein (Fragmen... 34 5.8
tr|B6MY39|B6MY39_BRAFL Putative uncharacterized protein OS=Branc... 34 5.8
tr|B4M6N5|B4M6N5_DROVI GJ16605 OS=Drosophila virilis GN=GJ16605 ... 33 9.8

>tr|B6NYK9|B6NYK9_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_239107 PE=4 SV=1
Length = 507

Score = 33.9 bits (76), Expect = 5.8
Identities = 17/55 (30%), Positives = 28/55 (50%)
Frame = +1

Query: 364 YQRHINKLSADQTGKSTLGRSHPESPLSKNTRMASACVSVRYMNHVSPNGQESSS 528
Y ++ + + TG ST +HP + L+ N+ SA V + Y+ H P G + S
Sbjct: 61 YGDYVPDANKECTGVSTFWIAHPNNVLTNNSAAGSAEVGIWYIFHDEPTGPSAGS 115


>tr|B6MY39|B6MY39_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_88250 PE=4 SV=1
Length = 1279

Score = 33.9 bits (76), Expect = 5.8
Identities = 17/55 (30%), Positives = 28/55 (50%)
Frame = +1

Query: 364 YQRHINKLSADQTGKSTLGRSHPESPLSKNTRMASACVSVRYMNHVSPNGQESSS 528
Y ++ + + TG ST +HP + L+ N+ SA V + Y+ H P G + S
Sbjct: 637 YGDYVPDANKECTGVSTFWIAHPNNVLTNNSAAGSAEVGIWYVFHDEPTGPSAGS 691


>tr|B4M6N5|B4M6N5_DROVI GJ16605 OS=Drosophila virilis GN=GJ16605 PE=4
SV=1
Length = 2043

Score = 33.1 bits (74), Expect = 9.8
Identities = 28/106 (26%), Positives = 46/106 (43%)
Frame = +1

Query: 214 LGR*HPESPLSKDTRMASACVSS**APLLESI*RQL*VNESGTSVCVHSHYQRHINKLSA 393
+G + SP S ASA S RQ+ +N+ TS + QR++++ S+
Sbjct: 1041 VGSPYARSPYSTVVEQASALSS-----------RQIVINDYHTSQQMQGQQQRNVSRGSS 1089

Query: 394 DQTGKSTLGRSHPESPLSKNTRMASACVSVRYMNHVSPNGQESSSN 531
G + G S ESP +N+ + + V Y P G+ S+
Sbjct: 1090 SAGGGAGSG-SDKESPSPRNSISSGSAVYAGYEKEPQPRGRPEYSS 1134