BP921685
Clone id YMU001_000152_H11
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000152_H11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTCCTAGCAAGCAATCGTATTCCACCTTGCACCATTATCAGCTCCTGATTGGTCTCATTC
ATGGCAAGGTTTGCAACAGCACCAGCAGCAACACGCCGAATGGTCTCATCCTCTGAGCTT
TGAAGGAGAGCAAGCAGAGACTCCAGACCTCCAGCTTCGACTATCTTTTCTTGATTAGCT
TCTTCAGCTGCCAGATTAGCTACCACTTTGACAGCATGGACACGAACATCCATGTCCTCA
GAATCCAGAAGAGATAAGATCTTCTGCAACCCAACTTGTTCAAACAGTTTTGCAATAGTG
GCCCGCTGACCATTGAGACATTCACGCATATGAATGGGTTTATGCGAATTCATTAGTGGT
GAATCTGACCCAATGGATGTTCTTGCAGGTTCCCTATCAAGGCTTTTCCTTGTCTCATCA
GCCTCAAAGCTTAATTGAAGAAGCTGCTGTTTCAAGGTTTTGACTTCATGTTCCAGAGTC
TTTTTGTGTTTTAGCTGTTCTTCAAGGTCATGACTCGAGGACTTCACATCATCTCTTAAA
TTGGCATTCTCTTCTTTGAGCTCTTTAGTCGTAAGAGCTGTCTTACTTCGCAAATCT
■■Homology search results ■■ -
sp_hit_id Q5VQ09
Definition sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica
Align length 169
Score (bit) 176.0
E-value 6.0e-44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921685|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_H11.
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like pr... 176 6e-44
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like pr... 170 4e-42
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like pr... 167 5e-41
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like pr... 131 2e-30
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like pr... 128 2e-29
sp|Q6BWW6|BRE1_DEBHA E3 ubiquitin-protein ligase BRE1 OS=Debaryo... 44 6e-04
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica G... 40 0.009
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum G... 40 0.009
sp|O67383|ARLY_AQUAE Argininosuccinate lyase OS=Aquifex aeolicus... 39 0.015
sp|Q5KPA7|VAC8_CRYNE Vacuolar protein 8 OS=Cryptococcus neoforma... 38 0.034
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus... 37 0.058
sp|Q9TW65|DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans GN=dy... 37 0.075
sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus G... 37 0.098
sp|Q9LW85|MFP1_ARATH MAR-binding filament-like protein 1 OS=Arab... 37 0.098
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii... 36 0.13
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans GN=V... 36 0.13
sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis GN=dc... 36 0.13
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevis... 36 0.17
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Pichia pastoris GN=VA... 36 0.17
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae GN=VA... 36 0.17
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii GN=VA... 36 0.17
sp|Q17635|NDC80_CAEEL Kinetochore protein ndc-80 OS=Caenorhabdit... 35 0.22
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 35 0.22
sp|O95202|LETM1_HUMAN LETM1 and EF-hand domain-containing protei... 35 0.22
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus GN=D... 35 0.22
sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens GN=DCTN... 35 0.22
sp|P12844|MYO3_CAEEL Myosin-3 OS=Caenorhabditis elegans GN=myo-3... 35 0.29
sp|Q8MUF6|MYSP_BLOTA Paramyosin OS=Blomia tropicalis PE=1 SV=1 35 0.37
sp|P16946|MX_STRP9 Virulence factor-related M protein OS=Strepto... 35 0.37
sp|B1WBU8|U639_RAT UPF0639 protein OS=Rattus norvegicus PE=2 SV=1 34 0.49

>sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein
2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2
SV=1
Length = 891

Score = 176 bits (447), Expect = 6e-44
Identities = 104/169 (61%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
Frame = -2

Query: 506 LEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPARTSI--GSDSPLMNSHKPI 333
L+ + K+ L+ E+ LK QLLQLS +ADETR+SLDR I G DS LM+ +
Sbjct: 555 LDTEASQKEKLDEEIAVLKSQLLQLSLDADETRRSLDRGDGSGKIFPGFDS-LMSHSRNS 613

Query: 332 HMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXX 153
RE NG + IAKLFEQVGLQKILSLL+SE+ DVRVHAVKVVANLAAEEANQEKIV
Sbjct: 614 QPREQSNGPKPPIAKLFEQVGLQKILSLLESEEPDVRVHAVKVVANLAAEEANQEKIVEA 673

Query: 152 XXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLA 6
EDETIRRVAAGA+ANLAMNETNQ+LIM QGG+ LL+
Sbjct: 674 GGLTSLLMLLRSSEDETIRRVAAGAIANLAMNETNQDLIMAQGGVSLLS 722


>sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein
3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1
Length = 919

Score = 170 bits (431), Expect = 4e-42
Identities = 96/186 (51%), Positives = 127/186 (68%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
E K+ A+ ++ LE + + K+ LE E+ TL QLLQLS ADETR++L++ +
Sbjct: 564 EFKKVEASGNSEIMRLHKMLENETQQKEKLEGEIATLHSQLLQLSLTADETRRNLEQHGS 623

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ G+ LM+ + +++ N ++ +A+LFEQVGLQKILSLL++ED DVR+HAVKV
Sbjct: 624 EKTSGARDSLMSQLRLPQIQDPGNAEKPPVARLFEQVGLQKILSLLEAEDADVRIHAVKV 683

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAEEANQ++IV EDETI RVAAGA+ANLAMNETNQELIM QG
Sbjct: 684 VANLAAEEANQQQIVEAGGLTSLLMLLKNTEDETIHRVAAGAIANLAMNETNQELIMDQG 743

Query: 23 GIRLLA 6
GI LL+
Sbjct: 744 GIGLLS 749


>sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein
2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2
Length = 894

Score = 167 bits (422), Expect = 5e-41
Identities = 102/197 (51%), Positives = 133/197 (67%), Gaps = 1/197 (0%)
Frame = -2

Query: 593 LRSKTALTTKELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADE 414
++S++ L T+ + E+A + K LE++ KK LE EV L+ QL+QL+FEAD+
Sbjct: 536 VKSQSTLKTRSGEGEDAGITRLQKL----LEDEALQKKKLEEEVTILRSQLVQLTFEADQ 591

Query: 413 TRKSLDR-EPARTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSE 237
R+ LDR P + G+DS L + H RE +NGQ+A A L EQVGLQKIL LL+S+
Sbjct: 592 MRRCLDRGAPGNSYSGTDS-LPSRHS--QARESVNGQKAPFATLCEQVGLQKILQLLESD 648

Query: 236 DMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMN 57
D ++R+HAVKVVANLAAEEANQEKIV EDET+RRVAAGA+ANLAMN
Sbjct: 649 DANIRIHAVKVVANLAAEEANQEKIVEAGGLTSLLMLLRSYEDETVRRVAAGAIANLAMN 708

Query: 56 ETNQELIMVQGGIRLLA 6
E +Q+LI+ QGGI LL+
Sbjct: 709 EVSQQLIVDQGGISLLS 725


>sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein
1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2
SV=2
Length = 945

Score = 131 bits (330), Expect = 2e-30
Identities = 78/186 (41%), Positives = 117/186 (62%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+L E + +++KS+ ++++++H++ LE E+ LKQ L E + + R +
Sbjct: 602 DLISEKELVYEELKSTQEKMQQEMRHRQGLEDEILRLKQSLADNCSEESKALCGMVR--S 659

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ +GS + S K RE L+ QR+ I+K+FE+VGL +L+LL S++++V++HAVKV
Sbjct: 660 GSGLGSVPFMSKSGKS---RELLSSQRSNISKIFEEVGLPNVLALLKSDELEVQIHAVKV 716

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAE+ NQEKIV E+ TI RV AGA+ANLAMN +NQ LIM +G
Sbjct: 717 VANLAAEDVNQEKIVEEGGLDALLSLLETSENTTIHRVTAGAIANLAMNGSNQGLIMNKG 776

Query: 23 GIRLLA 6
G RLLA
Sbjct: 777 GARLLA 782


>sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein
1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2
Length = 1051

Score = 128 bits (322), Expect = 2e-29
Identities = 76/187 (40%), Positives = 113/187 (60%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+L ++ L ++V+ L + K +K +E E+ LK+ L + +E R +E
Sbjct: 708 DLLQQKEKLGEEVRDMKERLLLEEKQRKQMESELSKLKKNLRESENVVEEKRYM--KEDL 765

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
S + +++ L+GQRAT+A+L E+VG+QKIL L+ SED++V++ AVKV
Sbjct: 766 SKGSAESGAQTGSQRSQGLKKSLSGQRATMARLCEEVGIQKILQLIKSEDLEVQIQAVKV 825

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAEEANQ KIV ++ TI RVA+GA+ANLAMNE +Q+LIM +G
Sbjct: 826 VANLAAEEANQVKIVEEGGVEALLMLVQSSQNSTILRVASGAIANLAMNEKSQDLIMNKG 885

Query: 23 GIRLLAR 3
G +LLA+
Sbjct: 886 GAQLLAK 892


>sp|Q6BWW6|BRE1_DEBHA E3 ubiquitin-protein ligase BRE1
OS=Debaryomyces hansenii GN=BRE1 PE=3 SV=2
Length = 691

Score = 43.9 bits (102), Expect = 6e-04
Identities = 36/139 (25%), Positives = 67/139 (48%), Gaps = 12/139 (8%)
Frame = -2

Query: 575 LTTKELKEENANLRDDVKSSSHDL------EEQLKHKKTL---EHEVKTLKQQLLQLSFE 423
L KEL+EEN L+ ++ S +DL ++L K+T+ + E +T +L +L+
Sbjct: 344 LLDKELREENETLKQQLQKSENDLVRIRTARDELLSKQTILKADFENQTTNDELNKLNKV 403

Query: 422 ADETRKSLDREPARTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQV---GLQKILS 252
+E +L+ E T S ++ + I LN + I + F++ L K++S
Sbjct: 404 LNERINALESERHETGDNSKISELSKDELIQRINMLNSEIKEIEQAFQETRENSLSKLMS 463

Query: 251 LLDSEDMDVRVHAVKVVAN 195
+ D E+M ++ K A+
Sbjct: 464 VTDQENMVKKLTIEKTKAD 482


>sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica
GN=VAC8 PE=3 SV=1
Length = 573

Score = 40.0 bits (92), Expect = 0.009
Identities = 24/93 (25%), Positives = 48/93 (51%)
Frame = -2

Query: 287 LFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXED 108
+ E G + ++ + S +++V+ +AV + NLA EAN+ KI +D
Sbjct: 145 IVEMGGFEPLIRQMMSPNVEVQCNAVGCITNLATHEANKSKIA-RSGALLPLTKLAKSKD 203

Query: 107 ETIRRVAAGAVANLAMNETNQELIMVQGGIRLL 9
++R A GA+ N+ ++ N++ ++ G I +L
Sbjct: 204 MRVQRNATGALLNMTHSDQNRQELVNAGAIPIL 236



Score = 32.7 bits (73), Expect = 1.4
Identities = 16/36 (44%), Positives = 22/36 (61%)
Frame = -2

Query: 110 DETIRRVAAGAVANLAMNETNQELIMVQGGIRLLAR 3
D I+R A+ A+ NLA+N N+ LI+ GG L R
Sbjct: 121 DPDIQRAASAALGNLAVNNENKVLIVEMGGFEPLIR 156



Score = 32.7 bits (73), Expect = 1.4
Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
Frame = -2

Query: 407 KSLDREPARTSIGSDSPLMN-SHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDM 231
KS D R + G+ L+N +H + +E +N I ++SLL S D
Sbjct: 200 KSKDMRVQRNATGA---LLNMTHSDQNRQELVNAGAIPI-----------LVSLLSSRDP 245

Query: 230 DVRVHAVKVVANLAAEEANQEKI 162
DV+ ++ ++N+A +E+N++K+
Sbjct: 246 DVQYYSTTALSNIAVDESNRKKL 268


>sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum
GN=VAC8 PE=3 SV=3
Length = 560

Score = 40.0 bits (92), Expect = 0.009
Identities = 24/90 (26%), Positives = 47/90 (52%)
Frame = -2

Query: 272 GLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRR 93
GLQ ++ + S +++V+ +AV + NLA E N+ KI +D ++R
Sbjct: 129 GLQPLIKQMMSPNVEVQCNAVGCITNLATHEENKAKIA-RSGALGPLTRLAKSKDMRVQR 187

Query: 92 VAAGAVANLAMNETNQELIMVQGGIRLLAR 3
A GA+ N+ ++ N++ ++ G I +L +
Sbjct: 188 NATGALLNMTHSDENRQQLVNAGAIPVLVQ 217



Score = 30.4 bits (67), Expect = 7.1
Identities = 14/36 (38%), Positives = 24/36 (66%)
Frame = -2

Query: 110 DETIRRVAAGAVANLAMNETNQELIMVQGGIRLLAR 3
D ++R A+ A+ NLA+N N+ LI+ GG++ L +
Sbjct: 100 DIEVQRAASAALGNLAVNTDNKVLIVQLGGLQPLIK 135


>sp|O67383|ARLY_AQUAE Argininosuccinate lyase OS=Aquifex aeolicus
GN=argH PE=3 SV=1
Length = 457

Score = 39.3 bits (90), Expect = 0.015
Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 11/120 (9%)
Frame = -2

Query: 572 TTKELKEENANLRDDVKSSSHDLEEQLKHKKTL-------EHEVKTLKQQLLQLSFEADE 414
T K +++ ++ D + + D+E+ + H KTL E E + L Q+LL++ E E
Sbjct: 13 TDKFVEDFTESVSFDKELAFEDIEQDIAHVKTLQKAGILTEEEARELIQELLKIKEEIKE 72

Query: 413 TRKSLDREPARTSIGSDSPLMNS----HKPIHMRECLNGQRATIAKLFEQVGLQKILSLL 246
+ +E + ++ L+N + +H N Q AT KL+ + ++++L LL
Sbjct: 73 GKFQWKKELEDVHMNIEAELINRLGDVGRKLHTARSRNDQVATDEKLYLKKEIKEVLQLL 132


>sp|Q5KPA7|VAC8_CRYNE Vacuolar protein 8 OS=Cryptococcus neoformans
GN=VAC8 PE=3 SV=3
Length = 630

Score = 38.1 bits (87), Expect = 0.034
Identities = 38/153 (24%), Positives = 73/153 (47%), Gaps = 6/153 (3%)
Frame = -2

Query: 449 QQLLQLSFEADETRKSLDREPARTSIGSDSPLMNSHKPIHMR--ECLNGQRATIAK---- 288
Q+ L+F A+ T K + RE R ++ L++SH P R G A A+
Sbjct: 65 QRSAALAF-AEITEKEV-REVGRDTLDPVLYLLSSHDPEVQRAASAALGNLAVNAENKLL 122

Query: 287 LFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXED 108
+ GL+ ++ + S +++V+ +AV + NLA + N+ +I +D
Sbjct: 123 VVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDENKTQIA-KSGALVPLTRLAKSKD 181

Query: 107 ETIRRVAAGAVANLAMNETNQELIMVQGGIRLL 9
++R A GA+ N+ ++ N++ ++ G I +L
Sbjct: 182 MRVQRNATGALLNMTHSDENRQQLVAAGAIPVL 214



Score = 34.7 bits (78), Expect = 0.37
Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
Frame = -2

Query: 260 ILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXEDE-TIRRVAA 84
++SLL+S D DV+ + ++N+A + AN++K+ ++ AA
Sbjct: 214 LVSLLNSPDTDVQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAA 273

Query: 83 GAVANLAMNETNQELIMVQGGIRLLAR 3
A+ NLA + Q I+ GG++ L R
Sbjct: 274 LALRNLASDSKYQLEIVKFGGLKPLLR 300



Score = 31.6 bits (70), Expect = 3.2
Identities = 22/89 (24%), Positives = 40/89 (44%)
Frame = -2

Query: 269 LQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRV 90
L + +L SE++D++ A A + +E + D ++R
Sbjct: 50 LAALTTLSFSENVDLQRSAALAFAEITEKEVRE----VGRDTLDPVLYLLSSHDPEVQRA 105

Query: 89 AAGAVANLAMNETNQELIMVQGGIRLLAR 3
A+ A+ NLA+N N+ L++ GG+ L R
Sbjct: 106 ASAALGNLAVNAENKLLVVSLGGLEPLIR 134


tr_hit_id A9TPE1
Definition tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 179
Score (bit) 199.0
E-value 1.0e-49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921685|Adiantum capillus-veneris mRNA, clone:
YMU001_000152_H11.
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment) OS=Physcomit... 199 1e-49
tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomit... 197 4e-49
tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment) OS=Physcomit... 187 3e-46
tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genom... 176 7e-43
tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza... 176 7e-43
tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza... 176 7e-43
tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genom... 175 2e-42
tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis... 168 2e-40
tr|B8AND9|B8AND9_ORYSI Putative uncharacterized protein OS=Oryza... 131 3e-29
tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genom... 131 3e-29
tr|A3AE81|A3AE81_ORYSJ Putative uncharacterized protein OS=Oryza... 113 7e-24
tr|Q23DA0|Q23DA0_TETTH Putative uncharacterized protein OS=Tetra... 42 0.020
tr|Q6CPF6|Q6CPF6_KLULA KLLA0E05281p OS=Kluyveromyces lactis GN=K... 42 0.027
tr|A8V0P4|A8V0P4_9AQUI Putative uncharacterized protein (Fragmen... 41 0.046
tr|A4A3E7|A4A3E7_9GAMM Putative uncharacterized protein OS=Congr... 40 0.078
tr|B0EAP7|B0EAP7_ENTDI GRIP domain-containing protein RUD3, puta... 40 0.078
tr|B6NBA3|B6NBA3_BRAFL Putative uncharacterized protein OS=Branc... 40 0.10
tr|B4KJW3|B4KJW3_DROMO GI17741 OS=Drosophila mojavensis GN=GI177... 40 0.10
tr|Q0VA06|Q0VA06_XENTR Leucine zipper-EF-hand containing transme... 40 0.13
tr|Q8S949|Q8S949_TOBAC Kinesin-like protein NACK2 OS=Nicotiana t... 40 0.13
tr|A9U0I4|A9U0I4_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.13
tr|A0DGF2|A0DGF2_PARTE Chromosome undetermined scaffold_5, whole... 40 0.13
tr|B2B5M3|B2B5M3_PODAN Predicted CDS Pa_2_5120 OS=Podospora anse... 39 0.17
tr|A8P222|A8P222_BRUMA Immunoglobulin I-set domain containing pr... 39 0.23
tr|Q2NJ67|Q2NJ67_AYWBP ATP-dependent Zn protease OS=Aster yellow... 39 0.29
tr|Q29JX8|Q29JX8_DROPS GA14882 OS=Drosophila pseudoobscura pseud... 39 0.29
tr|Q7SHC8|Q7SHC8_NEUCR Predicted protein OS=Neurospora crassa GN... 39 0.29
tr|Q6MGG0|Q6MGG0_NEUCR Related to vesicular transport protein OS... 39 0.29
tr|Q54VD6|Q54VD6_DICDI Dynactin 150 kDa subunit OS=Dictyostelium... 38 0.39
tr|B6P1C2|B6P1C2_BRAFL Putative uncharacterized protein OS=Branc... 38 0.39

>tr|A9TPE1|A9TPE1_PHYPA Predicted protein (Fragment) OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_148565 PE=3 SV=1
Length = 833

Score = 199 bits (505), Expect = 1e-49
Identities = 111/179 (62%), Positives = 136/179 (75%), Gaps = 2/179 (1%)
Frame = -2

Query: 533 DDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSL--DREPARTSIGSDS 360
D++ + H L+E+L+ ++ LE E++ LK+Q+ LS E +E + + + R+S+GS+S
Sbjct: 483 DELLTVRHRLDEELRERERLEEEIRHLKEQISVLSEEHEEHSRRIMANGGSGRSSLGSES 542

Query: 359 PLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEE 180
PL++ KP HMR+ +NGQRATIAKLFEQVGL KILSLL+SED+DVRVHAVKVVANLAAEE
Sbjct: 543 PLISISKPNHMRDTINGQRATIAKLFEQVGLHKILSLLESEDVDVRVHAVKVVANLAAEE 602

Query: 179 ANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLAR 3
ANQEKIV EDETIRRVAAGAVANLAMNETNQELIM QGGI LLAR
Sbjct: 603 ANQEKIVEAGGLGSLLMLLQSSEDETIRRVAAGAVANLAMNETNQELIMSQGGIGLLAR 661


>tr|A9RKE8|A9RKE8_PHYPA Predicted protein (Fragment) OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_115724 PE=3 SV=1
Length = 860

Score = 197 bits (501), Expect = 4e-49
Identities = 110/181 (60%), Positives = 135/181 (74%), Gaps = 4/181 (2%)
Frame = -2

Query: 533 DDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDRE----PARTSIGS 366
D++ + H L+E+L+ ++ +E E++ LK+Q+ L+ E +E + + R+SIGS
Sbjct: 512 DELLTVRHRLDEELRERERMEEEIRHLKEQVAVLTEEHEEHSRRIMTNGGMGSGRSSIGS 571

Query: 365 DSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAA 186
+SPL++ KP HMR+ +NGQRATIAKLFEQVGL KILSLL+SED+DVRVHAVKVVANLAA
Sbjct: 572 ESPLISMSKPSHMRDTINGQRATIAKLFEQVGLHKILSLLESEDVDVRVHAVKVVANLAA 631

Query: 185 EEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLA 6
EEANQEKIV EDETIRRVAAGAVANLAMNETNQELIM QGGI LLA
Sbjct: 632 EEANQEKIVEAGGLGSLLMLLQSSEDETIRRVAAGAVANLAMNETNQELIMSQGGIGLLA 691

Query: 5 R 3
R
Sbjct: 692 R 692


>tr|A9RQJ1|A9RQJ1_PHYPA Predicted protein (Fragment) OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_118031 PE=3 SV=1
Length = 845

Score = 187 bits (476), Expect = 3e-46
Identities = 110/196 (56%), Positives = 140/196 (71%), Gaps = 2/196 (1%)
Frame = -2

Query: 584 KTALTTKELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRK 405
K++ + K +K D++ + LE++LK + LE E + L++Q LS + ++TR+
Sbjct: 482 KSSASRKSMKGNIQKQSDELLTLRQRLEDELKERGRLESENRQLREQAGFLSDDEEQTRR 541

Query: 404 SLDREPA-RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMD 228
+D+ + R+S+GS+S + + P HMR+ +NGQRATIAKLFEQVGL KILSLL+SED+D
Sbjct: 542 MVDKGGSGRSSVGSESLPVGASNPDHMRDTINGQRATIAKLFEQVGLHKILSLLESEDVD 601

Query: 227 VRVHAVKVVANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMN-ET 51
VRVHAVKVVANLAAEE+NQEKIV EDETIRRVAAGAVANLAMN ET
Sbjct: 602 VRVHAVKVVANLAAEESNQEKIVEAGGLGSLLNLLQSSEDETIRRVAAGAVANLAMNAET 661

Query: 50 NQELIMVQGGIRLLAR 3
NQELIM QGGI LLAR
Sbjct: 662 NQELIMAQGGIGLLAR 677


>tr|A7PYA5|A7PYA5_VITVI Chromosome chr15 scaffold_37, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026364001
PE=3 SV=1
Length = 872

Score = 176 bits (447), Expect = 7e-43
Identities = 98/186 (52%), Positives = 125/186 (67%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+ + A ++ LE++ KK LE E+ L+ QLLQL+FEAD R+ L+R +
Sbjct: 518 QFTQPEAGGNSEILKLRKSLEDEAHKKKKLEEEITILQSQLLQLTFEADRMRRCLERGGS 577

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ LM+ +H+++ NGQRA+IA L EQVGLQK+LSLL+SED +VR+HAVKV
Sbjct: 578 GNAFTGLDSLMSQVGHLHLKDAGNGQRASIATLSEQVGLQKVLSLLESEDANVRIHAVKV 637

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAEEANQEKIV EDET+RRVAAGA+ANLAMNE NQELIMV+G
Sbjct: 638 VANLAAEEANQEKIVEAGGLSSLLMLLRRFEDETVRRVAAGAIANLAMNEANQELIMVEG 697

Query: 23 GIRLLA 6
GI LL+
Sbjct: 698 GISLLS 703


>tr|A3B870|A3B870_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019242 PE=3 SV=1
Length = 824

Score = 176 bits (447), Expect = 7e-43
Identities = 104/169 (61%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
Frame = -2

Query: 506 LEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPARTSI--GSDSPLMNSHKPI 333
L+ + K+ L+ E+ LK QLLQLS +ADETR+SLDR I G DS LM+ +
Sbjct: 488 LDTEASQKEKLDEEIAVLKSQLLQLSLDADETRRSLDRGDGSGKIFPGFDS-LMSHSRNS 546

Query: 332 HMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXX 153
RE NG + IAKLFEQVGLQKILSLL+SE+ DVRVHAVKVVANLAAEEANQEKIV
Sbjct: 547 QPREQSNGPKPPIAKLFEQVGLQKILSLLESEEPDVRVHAVKVVANLAAEEANQEKIVEA 606

Query: 152 XXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLA 6
EDETIRRVAAGA+ANLAMNETNQ+LIM QGG+ LL+
Sbjct: 607 GGLTSLLMLLRSSEDETIRRVAAGAIANLAMNETNQDLIMAQGGVSLLS 655


>tr|A2Y909|A2Y909_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21543 PE=3 SV=1
Length = 891

Score = 176 bits (447), Expect = 7e-43
Identities = 104/169 (61%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
Frame = -2

Query: 506 LEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPARTSI--GSDSPLMNSHKPI 333
L+ + K+ L+ E+ LK QLLQLS +ADETR+SLDR I G DS LM+ +
Sbjct: 555 LDTEASQKEKLDEEIAVLKSQLLQLSLDADETRRSLDRGDGSGKIFPGFDS-LMSHSRNS 613

Query: 332 HMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXX 153
RE NG + IAKLFEQVGLQKILSLL+SE+ DVRVHAVKVVANLAAEEANQEKIV
Sbjct: 614 QPREQSNGPKPPIAKLFEQVGLQKILSLLESEEPDVRVHAVKVVANLAAEEANQEKIVEA 673

Query: 152 XXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLA 6
EDETIRRVAAGA+ANLAMNETNQ+LIM QGG+ LL+
Sbjct: 674 GGLTSLLMLLRSSEDETIRRVAAGAIANLAMNETNQDLIMAQGGVSLLS 722


>tr|A7QK89|A7QK89_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001024001
PE=3 SV=1
Length = 844

Score = 175 bits (443), Expect = 2e-42
Identities = 97/167 (58%), Positives = 119/167 (71%)
Frame = -2

Query: 506 LEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPARTSIGSDSPLMNSHKPIHM 327
LE++ K+ LE E+ L+ QL QLSFEADET + LDR + +G+ ++ + +
Sbjct: 509 LEDEAHQKEKLEEEIAILQSQLFQLSFEADETSRQLDRGGSGKVLGNLDSFVSQIRHSQL 568

Query: 326 RECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKVVANLAAEEANQEKIVXXXX 147
+ NG +A+IAKLFEQVGLQKILSLL++ED DVR+HAVKVVANLAAEE NQEKIV
Sbjct: 569 SDSGNGDKASIAKLFEQVGLQKILSLLEAEDADVRIHAVKVVANLAAEETNQEKIVEAGG 628

Query: 146 XXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQGGIRLLA 6
EDETI+RVAAGA+ANLAMNETNQELIM QGGI LL+
Sbjct: 629 LSSLLMLLRSSEDETIQRVAAGAIANLAMNETNQELIMSQGGISLLS 675


>tr|A5BIN7|A5BIN7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029907 PE=3 SV=1
Length = 960

Score = 168 bits (426), Expect = 2e-40
Identities = 97/187 (51%), Positives = 124/187 (66%), Gaps = 1/187 (0%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+ + A ++ LE++ KK LE E+ L+ QLLQL+FEAD R+ L+R +
Sbjct: 660 QFTQPEAGGNSEILKLRKSLEDEAHKKKKLEEEITILQSQLLQLTFEADRMRRCLERGGS 719

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ LM+ + +++ NGQRA+IA L EQVGLQK+LSLL+SED +VR+HAVKV
Sbjct: 720 GNAFTGLDSLMSQVGHLXLKDAGNGQRASIATLSEQVGLQKVLSLLESEDANVRIHAVKV 779

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMN-ETNQELIMVQ 27
VANLAAEEANQEKIV EDET+RRVAAGA+ANLAMN E NQELIMV+
Sbjct: 780 VANLAAEEANQEKIVEAGGLSSLLMLLRRFEDETVRRVAAGAIANLAMNAEANQELIMVE 839

Query: 26 GGIRLLA 6
GGI LL+
Sbjct: 840 GGISLLS 846


>tr|B8AND9|B8AND9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10058 PE=4 SV=1
Length = 905

Score = 131 bits (330), Expect = 3e-29
Identities = 78/186 (41%), Positives = 117/186 (62%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+L E + +++KS+ ++++++H++ LE E+ LKQ L E + + R +
Sbjct: 563 DLISEKELVYEELKSTQEKMQQEMRHRQGLEDEILRLKQSLADNCSEESKALCGMVR--S 620

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ +GS + S K RE L+ QR+ I+K+FE+VGL +L+LL S++++V++HAVKV
Sbjct: 621 GSGLGSVPFMSKSGKS---RELLSSQRSNISKIFEEVGLPNVLALLKSDELEVQIHAVKV 677

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAE+ NQEKIV E+ TI RV AGA+ANLAMN +NQ LIM +G
Sbjct: 678 VANLAAEDVNQEKIVEEGGLDALLSLLETSENTTIHRVTAGAIANLAMNGSNQGLIMNKG 737

Query: 23 GIRLLA 6
G RLLA
Sbjct: 738 GARLLA 743


>tr|A7PI02|A7PI02_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018145001
PE=3 SV=1
Length = 995

Score = 131 bits (330), Expect = 3e-29
Identities = 78/186 (41%), Positives = 116/186 (62%)
Frame = -2

Query: 563 ELKEENANLRDDVKSSSHDLEEQLKHKKTLEHEVKTLKQQLLQLSFEADETRKSLDREPA 384
+L E A L +++ + + L + K +KT+E+E+ LK+ +L+ + ++ + +
Sbjct: 646 DLLSEKATLTEELHAVNQTLSVEEKQRKTIENELVKLKKLVLENDHDFEDKKSYVKESIG 705

Query: 383 RTSIGSDSPLMNSHKPIHMRECLNGQRATIAKLFEQVGLQKILSLLDSEDMDVRVHAVKV 204
+ S +P+ HK RE ++GQRATIAK+ E+ + IL+LL SED+DV++HAVKV
Sbjct: 706 KESSAFGAPV-GLHKSNPSRETISGQRATIAKICEEGKIFLILALLTSEDLDVQIHAVKV 764

Query: 203 VANLAAEEANQEKIVXXXXXXXXXXXXXXXEDETIRRVAAGAVANLAMNETNQELIMVQG 24
VANLAAE+ NQEKIV + TI RVA+GA+ANLAMNE NQ LI+ +G
Sbjct: 765 VANLAAEDINQEKIVEEGGLDALLLLLRSSKSTTILRVASGAIANLAMNELNQGLIISKG 824

Query: 23 GIRLLA 6
G +LLA
Sbjct: 825 GGQLLA 830