BP921691
Clone id YMU001_000153_A06
Library
Length 608
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGCATCTTTTGTTTTCGAGTTTGTTGCCACTTTCTTTCTCATGTTTATGAACATGAAG
GTGGCATGTAACATTGGGAAGGTTGGAGTTCTTGGAGGAGCTTTCATGGTAGGGATCACA
GTTGCGTTGTTAGGAATTTACGCAGGGCCATTGTGCGGTGGTTTGTCAATGAACCCTGCA
AGATCAATTGGACCTGCAGTAGTTGGATTGAAGTTTGAGTCCTTGTATATTTTTATATTG
GGGCCAGTAGGAGGAGCAATCCTTAGTGGAGTCACTTATGGTATAATTTGCCCAAAAGAT
AATGGTAAATTGTGTTGATAAACCAAATCCAATTTACCCATAGGTCCAAAATTTTGAAGT
ATAGCCTCAAAGTCCCCAAATGATCAAGACAAAGTCCGGACACATGATGGAGGTTTCAAG
GATCTCAGAGCTCACATGGCCAATTCTTTCATGGGGAAATAGTCCAAGTCCAATGTATGC
AACTACGTGAAACCTATATTTTCCTTGCTTGTTAAATTTGTATAAATATCAAAATTGTGA
GGTGATCTCTAGGAGACAACCGTAGTAAAAGCTATGGCCTTGAATGGAGGACACAAATGA
GCCAACTC
■■Homology search results ■■ -
sp_hit_id Q5Z9E2
Definition sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica
Align length 94
Score (bit) 84.3
E-value 4.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921691|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_A06.
(608 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp. ja... 84 4e-16
sp|Q40746|NIP11_ORYSJ Aquaporin NIP1-1 OS=Oryza sativa subsp. ja... 82 2e-15
sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2 77 5e-14
sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp. ja... 77 5e-14
sp|Q9ATN4|NIP11_MAIZE Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=... 76 2e-13
sp|Q9C6T0|NIP31_ARATH Putative aquaporin NIP3-1 OS=Arabidopsis t... 75 3e-13
sp|Q0DK16|NIP13_ORYSJ Aquaporin NIP1-3 OS=Oryza sativa subsp. ja... 74 6e-13
sp|Q8LFP7|NIP12_ARATH Aquaporin NIP1-2 OS=Arabidopsis thaliana G... 74 8e-13
sp|Q19KC1|NIP21_MAIZE Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=... 71 5e-12
sp|Q0JPT5|NIP12_ORYSJ Aquaporin NIP1-2 OS=Oryza sativa subsp. ja... 71 5e-12
sp|Q9SV84|NIP51_ARATH Probable aquaporin NIP5-1 OS=Arabidopsis t... 69 1e-11
sp|Q8LAI1|NIP71_ARATH Probable aquaporin NIP7-1 OS=Arabidopsis t... 69 2e-11
sp|Q67WJ8|NIP22_ORYSJ Aquaporin NIP2-2 OS=Oryza sativa subsp. ja... 69 2e-11
sp|Q9AT74|NIP23_MAIZE Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=... 69 2e-11
sp|Q9ATN2|NIP22_MAIZE Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=... 69 2e-11
sp|Q9FIZ9|NIP41_ARATH Putative aquaporin NIP4-1 OS=Arabidopsis t... 68 3e-11
sp|P49173|NIP1_NICAL Probable aquaporin NIP-type OS=Nicotiana al... 68 3e-11
sp|Q9SAI4|NIP61_ARATH Aquaporin NIP6-1 OS=Arabidopsis thaliana G... 67 9e-11
sp|Q8W036|NIP42_ARATH Probable aquaporin NIP4-2 OS=Arabidopsis t... 66 2e-10
sp|Q0IWF3|NIP31_ORYSJ Aquaporin NIP3-1 OS=Oryza sativa subsp. ja... 65 3e-10
sp|Q9ATN1|NIP31_MAIZE Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=... 64 5e-10
sp|Q9ASI1|NIP41_ORYSJ Aquaporin NIP4-1 OS=Oryza sativa subsp. ja... 64 6e-10
sp|Q41975|TIP22_ARATH Probable aquaporin TIP2-2 OS=Arabidopsis t... 62 2e-09
sp|Q8VZW1|NIP11_ARATH Aquaporin NIP1-1 OS=Arabidopsis thaliana G... 62 2e-09
sp|Q9FGL2|TIP23_ARATH Aquaporin TIP2-3 OS=Arabidopsis thaliana G... 60 1e-08
sp|Q9ATL8|TIP22_MAIZE Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=... 60 1e-08
sp|Q8W037|NIP21_ARATH Aquaporin NIP2-1 OS=Arabidopsis thaliana G... 59 1e-08
sp|Q9ATL9|TIP21_MAIZE Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=... 59 3e-08
sp|O77750|AQP4_BOVIN Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3 59 3e-08
sp|P47863|AQP4_RAT Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1... 58 3e-08

>sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp.
japonica GN=NIP1-4 PE=2 SV=1
Length = 273

Score = 84.3 bits (207), Expect = 4e-16
Identities = 47/94 (50%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EFV TF+LMF+ M VA + VG + G VG T+ L ++AGP+ G SMNPARS
Sbjct: 174 SLVIEFVITFYLMFVIMAVATDDQAVGHMAGV-AVGGTIMLNVLFAGPVSGA-SMNPARS 231

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
IGPA+VG K+ +L+++ILGP GA Y +I
Sbjct: 232 IGPALVGSKYTALWVYILGPFAGAAAGAWAYSLI 265



Score = 33.9 bits (76), Expect = 0.67
Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
Frame = +1

Query: 19 EFVATFFLMFMNM---KVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARSI 189
EF+ATFFLMF + V G V G A G V + +YA G +NPA ++
Sbjct: 62 EFLATFFLMFAGLGAITVEEKKGAVTFPGVAVAWGAAVMAM-VYAVGHVSGAHLNPAVTL 120

Query: 190 GPAVVG 207
G AV G
Sbjct: 121 GFAVAG 126


>sp|Q40746|NIP11_ORYSJ Aquaporin NIP1-1 OS=Oryza sativa subsp.
japonica GN=NIP1-1 PE=2 SV=1
Length = 284

Score = 82.4 bits (202), Expect = 2e-15
Identities = 43/94 (45%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EF+ TF+LMF+ VA + +G L G VG T+ L + AGP+ G SMNPARS
Sbjct: 166 SLVLEFIITFYLMFVISGVATDNRAIGELAG-LAVGATILLNVLIAGPISGA-SMNPARS 223

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA++G ++ S++++I+GPV GA+ Y II
Sbjct: 224 LGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNII 257


>sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2
Length = 271

Score = 77.4 bits (189), Expect = 5e-14
Identities = 44/94 (46%), Positives = 59/94 (62%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
+FVFEF+ TFFLMF+ VA + VG G +G T+ L I GP+ G SMNPARS
Sbjct: 156 AFVFEFIMTFFLMFVICGVATDNRAVGEFAG-IAIGSTLLLNVIIGGPVTGA-SMNPARS 213

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA V ++E ++I++L PV GAI Y I+
Sbjct: 214 LGPAFVHGEYEGIWIYLLAPVVGAIAGAWVYNIV 247


>sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp.
japonica GN=NIP2-1 PE=1 SV=1
Length = 298

Score = 77.4 bits (189), Expect = 5e-14
Identities = 44/101 (43%), Positives = 60/101 (59%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V E + TF +MF+ + VA + VG L G VG V + I+AG + GG SMNPAR+
Sbjct: 166 SLVVEVIVTFNMMFVTLAVATDTRAVGELAG-LAVGSAVCITSIFAGAISGG-SMNPART 223

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGIICPKDNGK 309
+GPA+ KF+ L+I+ LGPV G + TY I +D K
Sbjct: 224 LGPALASNKFDGLWIYFLGPVMGTLSGAWTYTFIRFEDTPK 264



Score = 33.5 bits (75), Expect = 0.87
Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
Frame = +1

Query: 13 VFEFVATFFLMFMNMKVA----CNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPA 180
V E VATF L+FM A ++ ++ LG + G+ V ++ IYA G MNPA
Sbjct: 52 VSEVVATFLLVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVM-IYAVGHISGAHMNPA 110

Query: 181 RSIGPAV 201
++ AV
Sbjct: 111 VTLAFAV 117


>sp|Q9ATN4|NIP11_MAIZE Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2
SV=1
Length = 282

Score = 75.9 bits (185), Expect = 2e-13
Identities = 40/94 (42%), Positives = 60/94 (63%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V E + TF+LMF+ VA + +G L G VG T+ L + AGP+ G SMNPARS
Sbjct: 162 SLVIEIITTFYLMFVISGVATDNRAIGELAG-LAVGATILLNVLIAGPVSGA-SMNPARS 219

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA+V ++ S++++++GPV GA+ Y +I
Sbjct: 220 VGPALVSGEYTSIWVYVVGPVVGAVAGAWAYNLI 253


>sp|Q9C6T0|NIP31_ARATH Putative aquaporin NIP3-1 OS=Arabidopsis
thaliana GN=NIP3-1 PE=3 SV=1
Length = 269

Score = 74.7 bits (182), Expect = 3e-13
Identities = 40/96 (41%), Positives = 62/96 (64%)
Frame = +1

Query: 1 SASFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPA 180
+ SFV EF+ATF LMF+ VA + G G +G T+ L +++GP+ G SMNPA
Sbjct: 112 TTSFVMEFIATFNLMFVISAVATDKRATGSFAG-IAIGATIVLDILFSGPISGA-SMNPA 169

Query: 181 RSIGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
RS+GPA++ ++ L+++I+ PV GA+ TYG++
Sbjct: 170 RSLGPALIWGCYKDLWLYIVSPVIGALSGAWTYGLL 205


>sp|Q0DK16|NIP13_ORYSJ Aquaporin NIP1-3 OS=Oryza sativa subsp.
japonica GN=NIP1-3 PE=3 SV=2
Length = 286

Score = 73.9 bits (180), Expect = 6e-13
Identities = 39/94 (41%), Positives = 59/94 (62%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S EF+ TF+LMF+ VA + +G L G VG TV + ++AGP+ G SMNPAR+
Sbjct: 172 SLAMEFIITFYLMFVVSGVATDNRAIGELAG-LAVGATVLVNVLFAGPISGA-SMNPART 229

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
IGPA++ ++ ++++I GPV GA+ Y +I
Sbjct: 230 IGPAIILGRYTGIWVYIAGPVFGAVAGAWAYNLI 263


>sp|Q8LFP7|NIP12_ARATH Aquaporin NIP1-2 OS=Arabidopsis thaliana
GN=NIP1-2 PE=1 SV=2
Length = 294

Score = 73.6 bits (179), Expect = 8e-13
Identities = 42/94 (44%), Positives = 58/94 (61%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
SFV EF+ TF+LMF+ VA + +G L G VG TV L I AGP+ G SMNP RS
Sbjct: 177 SFVIEFIITFYLMFVISGVATDNRAIGELAG-LAVGSTVLLNVIIAGPVSGA-SMNPGRS 234

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA+V + L+I+I+ P+ GA+ Y ++
Sbjct: 235 LGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMV 268


>sp|Q19KC1|NIP21_MAIZE Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2
SV=2
Length = 295

Score = 70.9 bits (172), Expect = 5e-12
Identities = 40/94 (42%), Positives = 55/94 (58%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V E + TF +MF+ + VA + VG L G VG V + I+AG + GG SMNPAR+
Sbjct: 164 SLVIEIIVTFNMMFVTLAVATDTRAVGELAG-LAVGSAVCITSIFAGAVSGG-SMNPART 221

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA+ + L+I+ LGPV G + TY I
Sbjct: 222 LGPALASNLYTGLWIYFLGPVLGTLSGAWTYTYI 255


>sp|Q0JPT5|NIP12_ORYSJ Aquaporin NIP1-2 OS=Oryza sativa subsp.
japonica GN=NIP1-2 PE=2 SV=2
Length = 303

Score = 70.9 bits (172), Expect = 5e-12
Identities = 37/90 (41%), Positives = 57/90 (63%)
Frame = +1

Query: 19 EFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARSIGPA 198
EFV +FFLMF+ VA + +G L G VG TVA+ ++AGP+ G SMNPARS+GPA
Sbjct: 192 EFVISFFLMFVVSGVATDNRAIGELAG-LAVGATVAVNVLFAGPVTGA-SMNPARSLGPA 249

Query: 199 VVGLKFESLYIFILGPVGGAILSGVTYGII 288
+V ++ +++++ PV G + Y ++
Sbjct: 250 MVAGRYGGVWVYVAAPVSGTVCGAWAYNLL 279


tr_hit_id A2YDZ2
Definition tr|A2YDZ2|A2YDZ2_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 94
Score (bit) 84.3
E-value 5.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921691|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_A06.
(608 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2YDZ2|A2YDZ2_ORYSI Putative uncharacterized protein OS=Oryza... 84 5e-15
tr|B7EFF6|B7EFF6_ORYSJ cDNA clone:J013160F10, full insert sequen... 82 2e-14
tr|A3A4V2|A3A4V2_ORYSJ Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|A2X2Q9|A2X2Q9_ORYSI Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|Q9FXW2|Q9FXW2_ADICA MIP OS=Adiantum capillus-veneris GN=AcMip... 80 7e-14
tr|A7QDF1|A7QDF1_VITVI Chromosome chr10 scaffold_81, whole genom... 79 2e-13
tr|B8AIG2|B8AIG2_ORYSI Putative uncharacterized protein OS=Oryza... 77 6e-13
tr|B7EGY5|B7EGY5_ORYSJ cDNA clone:J023031E16, full insert sequen... 77 6e-13
tr|A7NWG4|A7NWG4_VITVI Chromosome chr5 scaffold_2, whole genome ... 77 6e-13
tr|A6C836|A6C836_9PLAN MIP family channel protein OS=Planctomyce... 76 2e-12
tr|Q9XGG7|Q9XGG7_PEA Nodulin26-like major intrinsic protein OS=P... 76 2e-12
tr|B6TH33|B6TH33_MAIZE Aquaporin NIP1.2 OS=Zea mays PE=2 SV=1 76 2e-12
tr|B4FUJ5|B4FUJ5_MAIZE Putative uncharacterized protein OS=Zea m... 76 2e-12
tr|Q940D9|Q940D9_PINTA Early embryogenesis aquaglyceroporin OS=P... 75 4e-12
tr|A9SLH5|A9SLH5_PHYPA Predicted protein OS=Physcomitrella paten... 75 4e-12
tr|A9RZF0|A9RZF0_PHYPA Predicted protein OS=Physcomitrella paten... 74 5e-12
tr|A9P2J2|A9P2J2_PICSI Putative uncharacterized protein OS=Picea... 74 5e-12
tr|B2EIH4|B2EIH4_9BACT MIP family channel protein OS=bacterium E... 74 7e-12
tr|B8AZ46|B8AZ46_ORYSI Putative uncharacterized protein OS=Oryza... 74 7e-12
tr|Q6QIL2|Q6QIL2_MEDTR NIP2 OS=Medicago truncatula GN=NIP2 PE=2 ... 73 1e-11
tr|A7R832|A7R832_VITVI Chromosome undetermined scaffold_2214, wh... 73 1e-11
tr|A2ZQD6|A2ZQD6_ORYSJ Putative uncharacterized protein OS=Oryza... 73 1e-11
tr|Q9LKJ5|Q9LKJ5_LOTJA Multifunctional transport intrinsic membr... 73 1e-11
tr|B8LPH5|B8LPH5_PICSI Putative uncharacterized protein OS=Picea... 73 1e-11
tr|A3B0Z8|A3B0Z8_ORYSJ Putative uncharacterized protein OS=Oryza... 73 1e-11
tr|A7QV20|A7QV20_VITVI Chromosome undetermined scaffold_184, who... 72 2e-11
tr|Q7X9T0|Q7X9T0_CUCPE Nod26-like protein OS=Cucurbita pepo GN=N... 72 3e-11
tr|A3BCM9|A3BCM9_ORYSJ Putative uncharacterized protein OS=Oryza... 72 3e-11
tr|B8A6K8|B8A6K8_ORYSI Putative uncharacterized protein OS=Oryza... 71 6e-11
tr|B4FC34|B4FC34_MAIZE Putative uncharacterized protein OS=Zea m... 70 7e-11

>tr|A2YDZ2|A2YDZ2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23335 PE=3 SV=1
Length = 273

Score = 84.3 bits (207), Expect = 5e-15
Identities = 47/94 (50%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EFV TF+LMF+ M VA + VG + G VG T+ L ++AGP+ G SMNPARS
Sbjct: 174 SLVIEFVITFYLMFVIMAVATDDQAVGHMAGV-AVGGTIMLNVLFAGPVSGA-SMNPARS 231

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
IGPA+VG K+ +L+++ILGP GA Y +I
Sbjct: 232 IGPALVGSKYTALWVYILGPFAGAAAGAWAYSLI 265



Score = 33.9 bits (76), Expect = 7.5
Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
Frame = +1

Query: 19 EFVATFFLMFMNM---KVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARSI 189
EF+ATFFLMF + V G V G A G V + +YA G +NPA ++
Sbjct: 62 EFLATFFLMFTGLGAITVEEKKGAVTFPGVAVAWGAAVMAM-VYAVGHVSGAHLNPAVTL 120

Query: 190 GPAVVG 207
G AV G
Sbjct: 121 GFAVAG 126


>tr|B7EFF6|B7EFF6_ORYSJ cDNA clone:J013160F10, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 284

Score = 82.4 bits (202), Expect = 2e-14
Identities = 43/94 (45%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EF+ TF+LMF+ VA + +G L G VG T+ L + AGP+ G SMNPARS
Sbjct: 166 SLVLEFIITFYLMFVISGVATDNRAIGELAG-LAVGATILLNVLIAGPISGA-SMNPARS 223

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA++G ++ S++++I+GPV GA+ Y II
Sbjct: 224 LGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNII 257


>tr|A3A4V2|A3A4V2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005824 PE=3 SV=1
Length = 243

Score = 82.4 bits (202), Expect = 2e-14
Identities = 43/94 (45%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EF+ TF+LMF+ VA + +G L G VG T+ L + AGP+ G SMNPARS
Sbjct: 125 SLVLEFIITFYLMFVISGVATDNRAIGELAG-LAVGATILLNVLIAGPISGA-SMNPARS 182

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA++G ++ S++++I+GPV GA+ Y II
Sbjct: 183 LGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNII 216


>tr|A2X2Q9|A2X2Q9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06469 PE=3 SV=1
Length = 284

Score = 82.4 bits (202), Expect = 2e-14
Identities = 43/94 (45%), Positives = 62/94 (65%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V EF+ TF+LMF+ VA + +G L G VG T+ L + AGP+ G SMNPARS
Sbjct: 166 SLVLEFIITFYLMFVISGVATDNRAIGELAG-LAVGATILLNVLIAGPISGA-SMNPARS 223

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA++G ++ S++++I+GPV GA+ Y II
Sbjct: 224 LGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNII 257


>tr|Q9FXW2|Q9FXW2_ADICA MIP OS=Adiantum capillus-veneris GN=AcMip1
PE=2 SV=1
Length = 282

Score = 80.5 bits (197), Expect = 7e-14
Identities = 43/94 (45%), Positives = 60/94 (63%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S E + ++ LMF+ VA + +G L G VG VAL I+AGP+CG SMNPARS
Sbjct: 167 SLALEVITSYILMFVVSAVATDTRAIGELAG-LAVGSAVALDAIFAGPICGA-SMNPARS 224

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
IGPAV F+SL+++I+GP+ G +L +Y +I
Sbjct: 225 IGPAVASYDFKSLWVYIVGPILGCLLGAWSYTMI 258


>tr|A7QDF1|A7QDF1_VITVI Chromosome chr10 scaffold_81, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035815001
PE=3 SV=1
Length = 262

Score = 79.0 bits (193), Expect = 2e-13
Identities = 44/94 (46%), Positives = 59/94 (62%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
SFV EF+ TF+LMF+ VA + +G L G VG TV L ++AGP+ G SMNPARS
Sbjct: 145 SFVIEFIITFYLMFVISGVATDNRAIGELAG-LAVGATVLLNVMFAGPISGA-SMNPARS 202

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
+GPA+V + ++I++L P GAI Y II
Sbjct: 203 LGPAIVSNTYRGIWIYLLAPTCGAISGAWVYNII 236


>tr|B8AIG2|B8AIG2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08920 PE=4 SV=1
Length = 453

Score = 77.4 bits (189), Expect = 6e-13
Identities = 44/101 (43%), Positives = 60/101 (59%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V E + TF +MF+ + VA + VG L G VG V + I+AG + GG SMNPAR+
Sbjct: 213 SLVVEVIVTFNMMFVTLAVATDTRAVGELAG-LAVGSAVCITSIFAGAISGG-SMNPART 270

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGIICPKDNGK 309
+GPA+ KF+ L+I+ LGPV G + TY I +D K
Sbjct: 271 LGPALASNKFDGLWIYFLGPVMGTLSGAWTYTFIRFEDTPK 311



Score = 33.5 bits (75), Expect = 9.8
Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
Frame = +1

Query: 13 VFEFVATFFLMFMNMKVA----CNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPA 180
V E VATF L+FM A ++ ++ LG + G+ V ++ IYA G MNPA
Sbjct: 52 VSEVVATFLLVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVM-IYAVGHISGAHMNPA 110

Query: 181 RSIGPAV 201
++ AV
Sbjct: 111 VTLAFAV 117


>tr|B7EGY5|B7EGY5_ORYSJ cDNA clone:J023031E16, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 298

Score = 77.4 bits (189), Expect = 6e-13
Identities = 44/101 (43%), Positives = 60/101 (59%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S V E + TF +MF+ + VA + VG L G VG V + I+AG + GG SMNPAR+
Sbjct: 166 SLVVEVIVTFNMMFVTLAVATDTRAVGELAG-LAVGSAVCITSIFAGAISGG-SMNPART 223

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGIICPKDNGK 309
+GPA+ KF+ L+I+ LGPV G + TY I +D K
Sbjct: 224 LGPALASNKFDGLWIYFLGPVMGTLSGAWTYTFIRFEDTPK 264



Score = 33.5 bits (75), Expect = 9.8
Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
Frame = +1

Query: 13 VFEFVATFFLMFMNMKVA----CNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPA 180
V E VATF L+FM A ++ ++ LG + G+ V ++ IYA G MNPA
Sbjct: 52 VSEVVATFLLVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVM-IYAVGHISGAHMNPA 110

Query: 181 RSIGPAV 201
++ AV
Sbjct: 111 VTLAFAV 117


>tr|A7NWG4|A7NWG4_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019910001
PE=3 SV=1
Length = 293

Score = 77.4 bits (189), Expect = 6e-13
Identities = 39/96 (40%), Positives = 61/96 (63%)
Frame = +1

Query: 1 SASFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPA 180
S++F EF+ATF +MF+ + + V L G F+VGI + L + GP+ GG SMNPA
Sbjct: 177 SSAFWVEFIATFIIMFLAVSLTSQPQSVSHLSG-FVVGIAIGLAVLITGPVSGG-SMNPA 234

Query: 181 RSIGPAVVGLKFESLYIFILGPVGGAILSGVTYGII 288
RS+GPA+V KF+ ++I+ + P GA+ G + ++
Sbjct: 235 RSLGPAIVSWKFDDIWIYTIAPTLGAVAGGHLFHLL 270


>tr|A6C836|A6C836_9PLAN MIP family channel protein OS=Planctomyces
maris DSM 8797 GN=PM8797T_07554 PE=3 SV=1
Length = 228

Score = 75.9 bits (185), Expect = 2e-12
Identities = 39/101 (38%), Positives = 63/101 (62%)
Frame = +1

Query: 7 SFVFEFVATFFLMFMNMKVACNIGKVGVLGGAFMVGITVALLGIYAGPLCGGLSMNPARS 186
S + E V T+ LMF+ + V+ + G+L G +G +AL ++AGP+CG SMNPARS
Sbjct: 119 SLILEGVLTWMLMFVVLCVSTGAKETGILAGV-AIGAVIALEAMFAGPICGA-SMNPARS 176

Query: 187 IGPAVVGLKFESLYIFILGPVGGAILSGVTYGIICPKDNGK 309
+ PA+V +SL+++++GP GAIL+ + ++ N K
Sbjct: 177 LAPALVSNNLQSLWLYLVGPTAGAILAVPSLWLVRNNHNSK 217