BP921695
Clone id YMU001_000153_A10
Library
Length 627
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCGTGTAGATGCTTGGAGTGACTTGGCCTGTCCCTGGTGCTATGTCGGCAAGGCACGCTT
AGACAAGGCAATTCAGAACTTGAATCTAGATGCAATCCATCAGCAAACACAAGTTGTAGT
GCACTGGCATCCGTACATGATTGACATCAATACCACAAGTTCAGGTGAGGAGTACTTGGC
TTATAACAAGCGCAGATGGGGTTCTGATGGTTGGACATCGTCACTAAGGAGGTCTGGAGC
AAAGGATGGGCTTCGTTTCAAAGACTGGAAGTGGTGGCCCAATACTTTACATGCTCACAG
GTTAGTGCTCCTTGCGGACAGTGTTGGTAAAGGTGGGGAAGCAAAACAAGAGCTCTTCAG
ATTGACGTATGAAGAAGGTCAAAACATTTCTGATTTGGAGGTGCTGTGTGCCGCCGCCAA
CCAGCTCGGACTTTCTGGAGCAAGAGAGTATCTTATGTCTGATGAAGGAAAGCAGCAGGT
GATTAAGCAAGACAGGGCCGCAAAATCTGAGAGGAAGATTGATTCTGTCCCTTTCTTCAT
AGTCAATGGCTCTTACTCATTTTCAGGAGTGCAGGATGCAACAACTATTGAGGTCGTCCT
ACAAAAAGCAATGAGTTTGTAACGAGT
■■Homology search results ■■ -
sp_hit_id P39598
Definition sp|P39598|YWBO_BACSU Uncharacterized protein ywbO OS=Bacillus subtilis
Align length 184
Score (bit) 62.4
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921695|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_A10.
(627 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P39598|YWBO_BACSU Uncharacterized protein ywbO OS=Bacillus su... 62 2e-09
sp|A4XZJ9|Y4018_PSEMY UPF0229 protein Pmen_4018 OS=Pseudomonas m... 35 0.24
sp|Q4K4X0|Y5654_PSEF5 UPF0229 protein PFL_5654 OS=Pseudomonas fl... 35 0.31
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit S10B OS=Di... 35 0.41
sp|P52746|ZN142_HUMAN Zinc finger protein 142 OS=Homo sapiens GN... 34 0.54
sp|Q3K5S7|Y5140_PSEPF UPF0229 protein Pfl01_5140 OS=Pseudomonas ... 33 1.2
sp|Q5L1S1|Y824_GEOKA UPF0413 protein GK0824 OS=Geobacillus kaust... 32 2.0
sp|Q58729|Y1333_METJA Uncharacterized protein MJ1333 OS=Methanoc... 32 2.0
sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=C... 32 2.7
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protei... 31 5.9
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit S... 31 5.9
sp|Q54258|STRB1_STRGA Inosamine-phosphate amidinotransferase 1 O... 30 7.7
sp|Q8EN67|LEU1_OCEIH 2-isopropylmalate synthase OS=Oceanobacillu... 30 7.7
sp|Q9XDP1|DSBA_ENTAM Thiol:disulfide interchange protein dsbA OS... 30 7.7

>sp|P39598|YWBO_BACSU Uncharacterized protein ywbO OS=Bacillus
subtilis GN=ywbO PE=4 SV=1
Length = 200

Score = 62.4 bits (150), Expect = 2e-09
Identities = 49/184 (26%), Positives = 86/184 (46%), Gaps = 4/184 (2%)
Frame = +2

Query: 5 VDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAY 184
+ +SD CP+C+VGKA ++AI+ +++ ++ P + +N S ++Y+
Sbjct: 5 IKVYSDYVCPFCFVGKAAFEEAIKGKDVEVEWMPFELRPSPSPQLDPVNDPS--KQYM-- 60

Query: 185 NKRRWGSDGWTSSLRRSGAKDG--LRFKDWKWWPNTLHAHRLVLLADSVGKGGEAKQELF 358
W +S++ K G + F + P T A A KG E +F
Sbjct: 61 ---------WQTSIQPMAEKLGVEINFPNVSPHPYTDLAFEGFHFAKEYNKGHEYNTRVF 111

Query: 359 RLTYEEGQNISDLEVLCAAANQLGLSGAR-EYLMSDEGKQQVIKQD-RAAKSERKIDSVP 532
+ ++E QNI D+++L A ++GL GA + + Q V +Q + A E I +VP
Sbjct: 112 QAFFQEDQNIGDIDILTKLAEEVGLDGASFKSALETRTYQDVQRQALKHAYEEADITAVP 171

Query: 533 FFIV 544
FI+
Sbjct: 172 TFII 175


>sp|A4XZJ9|Y4018_PSEMY UPF0229 protein Pmen_4018 OS=Pseudomonas
mendocina (strain ymp) GN=Pmen_4018 PE=3 SV=1
Length = 423

Score = 35.4 bits (80), Expect = 0.24
Identities = 20/46 (43%), Positives = 25/46 (54%)
Frame = +2

Query: 290 HAHRLVLLADSVGKGGEAKQELFRLTYEEGQNISDLEVLCAAANQL 427
HA R+ L S K EAK EL RL EE N SD++ + A +L
Sbjct: 172 HARRIALSGSSRAKLREAKAELLRLRTEEPDNFSDIQEIEAEIERL 217


>sp|Q4K4X0|Y5654_PSEF5 UPF0229 protein PFL_5654 OS=Pseudomonas
fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_5654
PE=3 SV=1
Length = 424

Score = 35.0 bits (79), Expect = 0.31
Identities = 20/46 (43%), Positives = 25/46 (54%)
Frame = +2

Query: 290 HAHRLVLLADSVGKGGEAKQELFRLTYEEGQNISDLEVLCAAANQL 427
HA R+ L S K EAK+EL RL EE N D++ L A +L
Sbjct: 173 HARRIALSGSSRAKLREAKEELARLKREEPDNFGDIQELEAEIERL 218


>sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit S10B
OS=Dictyostelium discoideum GN=psmC6 PE=3 SV=1
Length = 393

Score = 34.7 bits (78), Expect = 0.41
Identities = 21/74 (28%), Positives = 35/74 (47%)
Frame = +2

Query: 302 LVLLADSVGKGGEAKQELFRLTYEEGQNISDLEVLCAAANQLGLSGAREYLMSDEGKQQV 481
L + A ++ K G+ E +G N +DL +C A + R+Y+M ++ + V
Sbjct: 317 LKIHAANITKHGDVDYEAIA-KLADGFNAADLRNVCTEAGMFAIRAERDYVMEEDFMKAV 375

Query: 482 IKQDRAAKSERKID 523
K A K E K+D
Sbjct: 376 RKCQEAKKLEGKLD 389


>sp|P52746|ZN142_HUMAN Zinc finger protein 142 OS=Homo sapiens
GN=ZNF142 PE=1 SV=3
Length = 1687

Score = 34.3 bits (77), Expect = 0.54
Identities = 33/155 (21%), Positives = 61/155 (39%), Gaps = 17/155 (10%)
Frame = -2

Query: 419 WRRHTAPPNQKCFDLLHTSI*RALVLLPHLYQHCPQGALTCEHVKYWATTSS-------- 264
++ H P ++CF + L+ HL+ H P +L C + + + T+ S
Sbjct: 160 FKTHMCPECKRCFK-------KRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLR 212

Query: 263 -L*NEAH--PLLQTSLVTMSNHQNPICACYKPSTPHLNLWY*CQSCTDASALQLVFADGL 93
L +AH PL S V + + + ++ + + Y C C + L + L
Sbjct: 213 ELGEKAHHCPLCHYSAVERNALNRHMASMHEDISNFYSDTYACPVCREEFRLSQALKEHL 272

Query: 92 HLDSSS------ELPCLSVPCRHSTRDRPSHSKHL 6
+++ L C C ++ DR + KHL
Sbjct: 273 KSHTAAAAAEPLPLRCFQEGCSYAAPDRKAFIKHL 307


>sp|Q3K5S7|Y5140_PSEPF UPF0229 protein Pfl01_5140 OS=Pseudomonas
fluorescens (strain Pf0-1) GN=Pfl01_5140 PE=3 SV=1
Length = 423

Score = 33.1 bits (74), Expect = 1.2
Identities = 19/46 (41%), Positives = 24/46 (52%)
Frame = +2

Query: 290 HAHRLVLLADSVGKGGEAKQELFRLTYEEGQNISDLEVLCAAANQL 427
HA R+ L S K E K+EL RL EE N D++ L A +L
Sbjct: 172 HARRIALSGSSRAKLREVKEELARLKREEPDNFGDIQDLEAEIERL 217


>sp|Q5L1S1|Y824_GEOKA UPF0413 protein GK0824 OS=Geobacillus
kaustophilus GN=GK0824 PE=3 SV=1
Length = 297

Score = 32.3 bits (72), Expect = 2.0
Identities = 33/136 (24%), Positives = 50/136 (36%), Gaps = 22/136 (16%)
Frame = +2

Query: 203 SDGWTSSLRRSGAKDGLRFKDWKWWPN------------------TLHAHRLVLLADSVG 328
S W + R G K K W+W N + A+ G
Sbjct: 64 SGTWATWSARKGTKPEAMAKAWEWAANRTGMSCDGSVWLENPISSPFAPSLAIKAAEMQG 123

Query: 329 K--GGEAKQELFRLTYEEGQNISDLEVLCAAANQLGLSGAREYL--MSDEGKQQVIKQDR 496
K G ++L + E QN++DL VL A + GL E+L M G + + D
Sbjct: 124 KRAGLRFLRKLQEQLFLEKQNVADLSVLAECAVKAGLD-VDEFLRDMHSPGAAKAFQCDL 182

Query: 497 AAKSERKIDSVPFFIV 544
SE +D +P ++
Sbjct: 183 KITSEMDVDEIPTLVL 198


>sp|Q58729|Y1333_METJA Uncharacterized protein MJ1333
OS=Methanocaldococcus jannaschii GN=MJ1333 PE=4 SV=1
Length = 84

Score = 32.3 bits (72), Expect = 2.0
Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
Frame = +2

Query: 341 AKQELFRLTYEEGQNISDL-EVLCAAANQLGLSGAREYLMSDEGK 472
+K+E F+ + + + D+ E++ A QLG+ GAR YL++ EG+
Sbjct: 40 SKREKFKEALYDAETVEDVYELIKAIKLQLGMQGARRYLLTLEGQ 84


>sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm
OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1
Length = 4568

Score = 32.0 bits (71), Expect = 2.7
Identities = 34/122 (27%), Positives = 47/122 (38%)
Frame = +2

Query: 212 WTSSLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLADSVGKGGEAKQELFRLTYEEGQNIS 391
W L GAK GLR KW + L +L+ D VG+G AK+ EE +
Sbjct: 947 WKPDLGEGGAKPGLRDMIKKWLQSFLEIGQLMKRLD-VGEGNYAKE------LEEDFEVY 999

Query: 392 DLEVLCAAANQLGLSGAREYLMSDEGKQQVIKQDRAAKSERKIDSVPFFIVNGSYSFSGV 571
D A NQ+ + ++ K Q K D K + + F NG G
Sbjct: 1000 D------ALNQVMMVTLANESRCEDFKNQFAKFDYLWKQDLQATLQQFITDNGVTLPDGT 1053

Query: 572 QD 577
+D
Sbjct: 1054 RD 1055


>sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A
OS=Mus musculus GN=Vps13a PE=1 SV=1
Length = 3166

Score = 30.8 bits (68), Expect = 5.9
Identities = 13/29 (44%), Positives = 21/29 (72%)
Frame = -3

Query: 550 AIDYEERDRINLPLRFCGPVLLNHLLLSF 464
AI + RD++N+ L CG V+LN+L+ +F
Sbjct: 1825 AISFYSRDQLNITLSKCGLVMLNNLVEAF 1853


tr_hit_id A7S8S9
Definition tr|A7S8S9|A7S8S9_NEMVE Predicted protein OS=Nematostella vectensis
Align length 185
Score (bit) 204.0
E-value 3.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921695|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_A10.
(627 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7S8S9|A7S8S9_NEMVE Predicted protein OS=Nematostella vectens... 204 3e-51
tr|B0EGD4|B0EGD4_ENTDI Putative uncharacterized protein OS=Entam... 158 3e-37
tr|B7G1G8|B7G1G8_PHATR Predicted protein OS=Phaeodactylum tricor... 134 3e-30
tr|A8I1J2|A8I1J2_CHLRE Predicted protein OS=Chlamydomonas reinha... 122 2e-26
tr|B8CG76|B8CG76_THAPS Predicted protein OS=Thalassiosira pseudo... 117 6e-25
tr|B7ZGN0|B7ZGN0_9PHAE DSBA oxidoreductase OS=Laminaria digitata... 112 1e-23
tr|B6QY76|B6QY76_9RHOB Dsba oxidoreductase OS=Pseudovibrio sp. J... 110 5e-23
tr|Q9RWK7|Q9RWK7_DEIRA FrnE protein OS=Deinococcus radiodurans G... 109 1e-22
tr|Q1IWL7|Q1IWL7_DEIGD DSBA oxidoreductase OS=Deinococcus geothe... 107 4e-22
tr|A9RXI1|A9RXI1_PHYPA Predicted protein OS=Physcomitrella paten... 107 6e-22
tr|Q5LRQ5|Q5LRQ5_SILPO DSBA-like thioredoxin family protein OS=S... 106 1e-21
tr|A9CIN4|A9CIN4_AGRT5 Polyketide biosynthesis associated protei... 105 2e-21
tr|A7HXQ6|A7HXQ6_PARL1 DSBA oxidoreductase OS=Parvibaculum lavam... 105 2e-21
tr|Q98MM5|Q98MM5_RHILO Mlr0515 protein OS=Rhizobium loti GN=mlr0... 105 2e-21
tr|B7RQ42|B7RQ42_9RHOB Dsba oxidoreductase OS=Roseobacter sp. GA... 104 4e-21
tr|A3JFI2|A3JFI2_9ALTE Hypothetical 2-hydroxychromene-2-carboxyl... 104 5e-21
tr|A0NSL9|A0NSL9_9RHOB FrnE protein, putative OS=Labrenzia aggre... 104 5e-21
tr|A3HSU7|A3HSU7_9SPHI Predicted dithiol-disulfide isomerase OS=... 103 6e-21
tr|A1K7U5|A1K7U5_AZOSB Putative uncharacterized protein OS=Azoar... 103 1e-20
tr|A9NYS1|A9NYS1_PICSI Putative uncharacterized protein OS=Picea... 102 1e-20
tr|Q92PT6|Q92PT6_RHIME Putative uncharacterized protein OS=Rhizo... 102 2e-20
tr|A6EXA4|A6EXA4_9ALTE DSBA oxidoreductase OS=Marinobacter algic... 101 3e-20
tr|Q11HN0|Q11HN0_MESSB DSBA oxidoreductase OS=Mesorhizobium sp. ... 100 7e-20
tr|Q6N327|Q6N327_RHOPA Putatively similar to frnE protein OS=Rho... 99 2e-19
tr|B3QI85|B3QI85_RHOPT DSBA oxidoreductase OS=Rhodopseudomonas p... 99 2e-19
tr|Q6FF72|Q6FF72_ACIAD Putative uncharacterized protein OS=Acine... 99 2e-19
tr|Q085X9|Q085X9_SHEFN DSBA oxidoreductase OS=Shewanella frigidi... 99 2e-19
tr|Q7S4H3|Q7S4H3_NEUCR Predicted protein OS=Neurospora crassa GN... 99 2e-19
tr|A9F7G1|A9F7G1_SORC5 DSBA oxidoreductase OS=Sorangium cellulos... 99 3e-19
tr|A6U9B4|A6U9B4_SINMW DSBA oxidoreductase OS=Sinorhizobium medi... 99 3e-19

>tr|A7S8S9|A7S8S9_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g208543 PE=4 SV=1
Length = 218

Score = 204 bits (519), Expect = 3e-51
Identities = 98/185 (52%), Positives = 127/185 (68%), Gaps = 3/185 (1%)
Frame = +2

Query: 5 VDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAY 184
+DA+SDLACPWCYVGK LD AI + + T ++V+WHPY+ID NT +GE+Y+ Y
Sbjct: 6 IDAYSDLACPWCYVGKGHLDNAISQFT--SSNPTTNIIVNWHPYIIDKNTAENGEKYINY 63

Query: 185 NKRRWGSDGWTSSLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLAD-SVGKGGE--AKQEL 355
N RRWG DGWT SLR SG + GL FK+W+ WPNTLHAHR+V LA G G+ AK L
Sbjct: 64 NVRRWGGDGWTQSLRNSGRQIGLEFKNWQIWPNTLHAHRVVHLAGVQKGPAGQNMAKNVL 123

Query: 356 FRLTYEEGQNISDLEVLCAAANQLGLSGAREYLMSDEGKQQVIKQDRAAKSERKIDSVPF 535
FR+ YEEG+NISD+++L AA ++GL A YL SDE ++ +D AKS+ +I VP
Sbjct: 124 FRMIYEEGENISDIDILIKAAGEIGLGRADSYLRSDEDVDIILFEDSQAKSKLRISGVPL 183

Query: 536 FIVNG 550
F + G
Sbjct: 184 FKIRG 188


>tr|B0EGD4|B0EGD4_ENTDI Putative uncharacterized protein
OS=Entamoeba dispar SAW760 GN=EDI_226260 PE=4 SV=1
Length = 209

Score = 158 bits (399), Expect = 3e-37
Identities = 85/206 (41%), Positives = 121/206 (58%), Gaps = 6/206 (2%)
Frame = +2

Query: 17 SDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAYNKRR 196
SD++CPWCYVG+ R+ AI + + ++ +HPY+ID+ T GEEY+AYN RR
Sbjct: 10 SDISCPWCYVGRKRMLNAISTI------KNKEISYEYHPYIIDMKTKKDGEEYMAYNVRR 63

Query: 197 WGSDGWTSSLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLADSVGKGGEAKQELFRLTYEE 376
WG DGWT S+ R DG F WK+WP +LH HRL++ A+++GKG E F++ YEE
Sbjct: 64 WGGDGWTYSMIRDSKADGCNFAQWKYWPYSLHCHRLMIYANTIGKGNELMGIYFQMNYEE 123

Query: 377 GQNISDLEVLCAAANQLG--LSGAREYLMSDEGKQQVIKQDRAAKSERKIDSVPFFIV-- 544
G+N+S L AA + G L+ A+ + SDE K V+++ S I VPFFI+
Sbjct: 124 GKNLSIQSGLMEAAERCGLDLTIAKRIITSDENKDIVMRELHNWHS-MGISGVPFFIIEF 182

Query: 545 -NG-SYSFSGVQDATTIEVVLQKAMS 616
NG + SG ++ V+QK S
Sbjct: 183 GNGKQVTLSGAVSSSKWLSVIQKYSS 208


>tr|B7G1G8|B7G1G8_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_46509 PE=4 SV=1
Length = 211

Score = 134 bits (338), Expect = 3e-30
Identities = 73/197 (37%), Positives = 108/197 (54%), Gaps = 13/197 (6%)
Frame = +2

Query: 56 RLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAYNKRRWGSDGWTSSLRRS 235
RL KAI + ++ + V V W PY ID T +GEE+ AY KRRWG GWT L+
Sbjct: 13 RLQKAIDHFTVNG---KLPVEVEWKPYQIDPGTEPNGEEFNAYCKRRWGGSGWTQHLQSE 69

Query: 236 GAKDGLRFKDWKWWPNTLHAHRLVLLADSVGKGG----EAKQELFRLTYEEGQNISDLEV 403
G K+G RF +WKWWPNTL H+ ++ K G +A + LFR YE+G+N+SD E
Sbjct: 70 GVKNGARFSNWKWWPNTLRGHQWIMYGKE--KHGLDTNKANEVLFRALYEQGENLSDTET 127

Query: 404 LCAAAN----QLGLSGAREYLMSDEGKQQVIKQDRAAKSERKIDSVPFFIVNGS-----Y 556
L A ++ + R+Y+ D+G +V+++ + I VPFF+V + Y
Sbjct: 128 LIRLAENTLPEVDVEDLRDYITKDKGAARVMQEIDRGRRAFGIQGVPFFVVGATGLATPY 187

Query: 557 SFSGVQDATTIEVVLQK 607
+FSG Q + + V ++
Sbjct: 188 AFSGAQASESFLEVFEE 204


>tr|A8I1J2|A8I1J2_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_182629 PE=4 SV=1
Length = 288

Score = 122 bits (305), Expect = 2e-26
Identities = 75/208 (36%), Positives = 109/208 (52%), Gaps = 13/208 (6%)
Frame = +2

Query: 5 VDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAY 184
V +SD ACPWC++G RL +A++ Q + + W+P ++D + +++GEE +Y
Sbjct: 30 VHVFSDPACPWCHIGAKRLQRAVRQYKR-RYGQAAPLQLAWNPLLVDSDVSAAGEEVESY 88

Query: 185 NKRRWG---SDGWTSSLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLADSVGKGGEAKQEL 355
RRWG S W + L RSG +G F DW+ PNTL A LV +A G +A L
Sbjct: 89 AARRWGLQSSAEWRARLSRSGLPEGAAFADWRTVPNTLLAAELVAIATDQGLADQAVDLL 148

Query: 356 FRLTYEEGQNISDLEVLCAAANQLGLSG---AREYLMSD-EGKQQVIKQDRAAKSERKID 523
F TYEEG NIS L L LG+ RE SD + + V+++D AAK KI+
Sbjct: 149 FTRTYEEGANISLLGELLDIGEALGMQRHELRRELTRSDSQVRAAVMERDAAAKQRLKIN 208

Query: 524 SVPFFIV------NGSYSFSGVQDATTI 589
++P +IV YS +G + +
Sbjct: 209 AIPHYIVCAGPNSRTKYSLNGAHQTSDL 236


>tr|B8CG76|B8CG76_THAPS Predicted protein OS=Thalassiosira
pseudonana CCMP1335 GN=THAPSDRAFT_12012 PE=4 SV=1
Length = 189

Score = 117 bits (293), Expect = 6e-25
Identities = 71/187 (37%), Positives = 102/187 (54%), Gaps = 26/187 (13%)
Frame = +2

Query: 137 MIDINTTSSGEEYLAYNKRRWGSDGWTSSLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLA 316
MID T + GEE+ AYN RRWGS GWT SL+R+G K G F DWK WPNTL AH+L+
Sbjct: 1 MIDPGTKTDGEEFEAYNIRRWGSSGWTHSLKRAGRKVGANFNDWKVWPNTLKAHQLIAYV 60

Query: 317 DSVGKGGEAKQE----------LFRLTYEEGQNISDLEVLC-AAANQLGLSGA-----RE 448
+ GE + + +F YE G+NIS E L A ++LG+S + +
Sbjct: 61 TDPKRHGENESKPTTTSECNAAIFDAMYECGENISLTETLVKIATDRLGVSQSEVPLLQT 120

Query: 449 YLMSDEGKQQVIKQDRAAKSERKIDSVPFFIVNG---------SYSFSGVQDATT-IEVV 598
+L ++EG + V+++ + + I VP+FI+ Y FSG QD +T +E+
Sbjct: 121 HLENNEGGKDVMREIQTGRKRYNIQGVPYFIIGAVDGEQSLGRPYGFSGAQDPSTFVEIF 180

Query: 599 LQKAMSL 619
+ A SL
Sbjct: 181 EELAASL 187


>tr|B7ZGN0|B7ZGN0_9PHAE DSBA oxidoreductase OS=Laminaria digitata
GN=dsba PE=2 SV=1
Length = 221

Score = 112 bits (281), Expect = 1e-23
Identities = 59/185 (31%), Positives = 104/185 (56%), Gaps = 8/185 (4%)
Frame = +2

Query: 17 SDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVV----VHWHPYMIDINTTSSGEEYLA- 181
SD CPWCYVGK L+ A++ ++ Q V W P+ +++ + + EE +
Sbjct: 10 SDNVCPWCYVGKRNLESAMKQFATSQPTEKEQEPPVFDVRWKPFFLNVKSPETSEEPIQE 69

Query: 182 YNKRRWGSDGWTS---SLRRSGAKDGLRFKDWKWWPNTLHAHRLVLLADSVGKGGEAKQE 352
Y ++++G + +L R+G G+ F + + NT+ +HRLV LAD KGG+ ++
Sbjct: 70 YLEKKYGKGAGSRMAVALERAGKSTGINFNNDRRVHNTIRSHRLVRLADQQEKGGDMIEQ 129

Query: 353 LFRLTYEEGQNISDLEVLCAAANQLGLSGAREYLMSDEGKQQVIKQDRAAKSERKIDSVP 532
LF +EEG+NI+D +VL A + G+ +EYL EG+Q+V+ + + + + VP
Sbjct: 130 LFHGYFEEGKNIADSDVLLEIAQKAGVECTKEYLEGKEGQQEVLNEYQKGVQTQGVSGVP 189

Query: 533 FFIVN 547
++I++
Sbjct: 190 YYIIS 194


>tr|B6QY76|B6QY76_9RHOB Dsba oxidoreductase OS=Pseudovibrio sp.
JE062 GN=PJE062_1467 PE=4 SV=1
Length = 218

Score = 110 bits (276), Expect = 5e-23
Identities = 64/210 (30%), Positives = 116/210 (55%), Gaps = 8/210 (3%)
Frame = +2

Query: 5 VDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLAY 184
+D SD+ CPWC++GK RL+KA+ L ++ V V WHPY +D G++ Y
Sbjct: 9 IDVISDVMCPWCFIGKRRLEKALMML------PESTVKVQWHPYQLDATLPKEGKDRKKY 62

Query: 185 NKRRWG----SDGWTSSLRRSGAKDGL--RFKDWKWWPNTLHAHRLVLLADSVGKGGEAK 346
+ ++G ++ S +R +G + + +F+ K PNT+ +HRL+ A S G
Sbjct: 63 LEDKFGGPERAEQAYSHVRNAGVAEDIDFQFEAIKKSPNTIDSHRLIRWARSEGMQDAMV 122

Query: 347 QELFRLTYEEGQNISDLEVLCAAANQLGLSG--AREYLMSDEGKQQVIKQDRAAKSERKI 520
+ELF+L + EG +++D +VL AA + GL+ + L +D+ ++V + D E +
Sbjct: 123 EELFKLYFTEGADLTDKQVLVDAAERAGLNSKLVSDLLDTDQDVKEV-EADVFRAHEIGV 181

Query: 521 DSVPFFIVNGSYSFSGVQDATTIEVVLQKA 610
VPFF+++G ++ +G ++ T+ ++ A
Sbjct: 182 TGVPFFVIDGRFAVAGAENPETLAAAIRHA 211


>tr|Q9RWK7|Q9RWK7_DEIRA FrnE protein OS=Deinococcus radiodurans
GN=DR_0659 PE=4 SV=1
Length = 252

Score = 109 bits (273), Expect = 1e-22
Identities = 68/204 (33%), Positives = 103/204 (50%), Gaps = 8/204 (3%)
Frame = +2

Query: 2 RVDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMID-----INTTSSG 166
RVD WSD+ACPWCY+GK R + A L Q+ QV V WH + +D +N +
Sbjct: 13 RVDIWSDIACPWCYIGKRRFESA-----LGQFPQRDQVEVVWHSFELDPSARPLNPIAMR 67

Query: 167 EEY-LAYNKRRWGSDGWTSSLRRSGAKDGLRFK-DWKWWPNTLHAHRLVLLADSVGKGGE 340
+ + Y+ + G + ++ A++GL + D NT AH+L+ A G+G
Sbjct: 68 DGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDA 127

Query: 341 AKQELFRLTYEEGQNISDLEVLCAAANQLGL-SGAREYLMSDEGKQQVIKQDRAAKSERK 517
K+ L R EGQN++DL+ L A ++GL +GA + Q ++ D A +
Sbjct: 128 MKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLG 187

Query: 518 IDSVPFFIVNGSYSFSGVQDATTI 589
I VPFF++ G Y SG Q T+
Sbjct: 188 ITGVPFFVLGGKYGVSGAQAPETL 211


>tr|Q1IWL7|Q1IWL7_DEIGD DSBA oxidoreductase OS=Deinococcus
geothermalis (strain DSM 11300) GN=Dgeo_2073 PE=4 SV=1
Length = 256

Score = 107 bits (268), Expect = 4e-22
Identities = 70/210 (33%), Positives = 103/210 (49%), Gaps = 8/210 (3%)
Frame = +2

Query: 2 RVDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMID----INTTSSGE 169
RVD WSDLACPWC +GK R ++A+ + + QV V WH + +D + + S
Sbjct: 13 RVDIWSDLACPWCSIGKRRFEQALAGFS-----HRDQVGVVWHSFELDPSAPVQSPLSLR 67

Query: 170 EYLA--YNKRRWGSDGWTSSLRRSGAKDGLRFKDWKWWP-NTLHAHRLVLLADSVGKGGE 340
E LA Y + + S+ R+ A +GL + + P NT AH+L LA G
Sbjct: 68 EGLARKYGRTLQQAQDMLDSMTRTAAGEGLDYHFERVQPTNTFLAHQLTHLAAEKGLADA 127

Query: 341 AKQELFRLTYEEGQNISDLEVLCAAANQLGLSGAREYLMSDEGK-QQVIKQDRAAKSERK 517
++ LF EG+ + D EVL A+++GL A + G Q ++QD A
Sbjct: 128 MEERLFAAYLSEGELLGDPEVLVRLASEVGLDAAEVRAALERGTYAQAVRQDEAQAQALG 187

Query: 518 IDSVPFFIVNGSYSFSGVQDATTIEVVLQK 607
I VPFF++ G Y SG Q A + L++
Sbjct: 188 ITGVPFFVLGGKYGVSGAQPAEVLRSALEQ 217


>tr|A9RXI1|A9RXI1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_206589 PE=4 SV=1
Length = 214

Score = 107 bits (267), Expect = 6e-22
Identities = 73/215 (33%), Positives = 110/215 (51%), Gaps = 12/215 (5%)
Frame = +2

Query: 2 RVDAWSDLACPWCYVGKARLDKAIQNLNLDAIHQQTQVVVHWHPYMIDINTTSSGEEYLA 181
RVD SD CPWC+VGK L+KAI +A + V V WHP+ ++ + + G
Sbjct: 7 RVDVTSDTVCPWCFVGKKHLEKAI-----EACKDRYDVEVKWHPFFLNPDASVKGVNKKE 61

Query: 182 YNKRRWGSDGWTSSLRRSG---AKDGLRFKDWKWWPNTLHAHRLVLLADSVG--KGGEAK 346
Y + ++G + G A G +F +TL +HRL+ LA G K
Sbjct: 62 YYRSKFGEGRMHMIVDHVGAAFANLGYKFSIGGETGSTLDSHRLIELAGRQGLKKQNALV 121

Query: 347 QELFRLTYEEGQNISDLEVLCAAANQLGLSGAREYLMSDE-GKQQVIKQDRAAKSERKID 523
+ELF + E + I D VL AAA ++G+ GARE+L + G ++V+ ++R K R +
Sbjct: 122 EELFVNFFTEEKYIGDKNVLVAAAEKVGIEGAREFLDDPQAGLKEVLAEER--KFRRGVS 179

Query: 524 SVPFFIVNGSYSFSGVQ------DATTIEVVLQKA 610
VP F+++G Y SG Q +A I V+L K+
Sbjct: 180 GVPHFVIDGRYQVSGAQPPEVFIEAFEISVILDKS 214