BP921729
Clone id YMU001_000153_E01
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGCTTTTAAAATATTTTCCTTCAAAATGGCGGAGCCATATTTTGAACCTCTGTATCAGGA
TGTCGACAAAGTTGGAAGATAGCATCCTTTATACTTTCTGCACCAGACCGAGTAGGCTCC
GCATTTATTTGCTCAATGGTCAGGATACGTCTAACAGCTAGAAACTCCAAGACCTTTAAA
ATCTTACGGATGATGGGGGTCCTCTTGTAGTCCATCCTGCTTTGCTTTACAATCTTGTGC
ATTATCTGGGAACCGTTTCTACTAAGAACTTCCAAAAGAATCGCCCTTGACTGGGTCTTC
AGCAATGCATCCAATACCAATGAAAGATCCCTTGTACTTTTTGATCCCTCTCCACTTGAT
GTGTCACTCGAGGAGAAAGCTGTCCGCACTAGAAGCTTTAAATAACTTGTTGCAACTTCA
GGCTGGCTCTTGCATAAGCCTCCATTTTCATCTATCAGCTTGTGTAGTTCTTCTTCCACT
CCTTCAAAATGACCTCCATAGATTTCGATTGTCAACTT
■■Homology search results ■■ -
sp_hit_id Q2LAE1
Definition sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana
Align length 78
Score (bit) 54.3
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921729|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_E01.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 O... 54 3e-07
sp|Q58581|Y1181_METJA Uncharacterized protein MJ1181 OS=Methanoc... 32 1.4
sp|Q5UQB9|YL222_MIMIV Putative SET domain-containing protein L22... 30 6.8
sp|Q8CJ11|GPR64_RAT G-protein coupled receptor 64 OS=Rattus norv... 30 6.8
sp|Q8IZP9|GPR64_HUMAN G-protein coupled receptor 64 OS=Homo sapi... 30 8.8

>sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2
OS=Arabidopsis thaliana GN=ASHH2 PE=2 SV=1
Length = 1759

Score = 54.3 bits (129), Expect = 3e-07
Identities = 31/78 (39%), Positives = 51/78 (65%)
Frame = -1

Query: 485 EGVEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDA 306
E E +L++L+D GG+ K + + A YLKLL+ TA RDLS++LDA
Sbjct: 1373 ETFEGKLNELLDAVGGISKRR-DSAKGYLKLLLLTA--ASRGTDEEGIYSNRDLSMILDA 1429

Query: 305 LLKTQSRAILLEVLSRNG 252
LLKT+S+++L++++++NG
Sbjct: 1430 LLKTKSKSVLVDIINKNG 1447


>sp|Q58581|Y1181_METJA Uncharacterized protein MJ1181
OS=Methanocaldococcus jannaschii GN=MJ1181 PE=4 SV=1
Length = 199

Score = 32.3 bits (72), Expect = 1.4
Identities = 15/54 (27%), Positives = 31/54 (57%)
Frame = -1

Query: 230 VKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIKDAIFQL 69
++ + DY+ P+I K++K +E + ++ + IN + + +E +KD IF L
Sbjct: 142 IEHIKFDYRLEPVIPKVIKFVEAMKLQGL-----INGKLKDASSEEVKDIIFDL 190


>sp|Q5UQB9|YL222_MIMIV Putative SET domain-containing protein L222
OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L222 PE=4
SV=1
Length = 314

Score = 30.0 bits (66), Expect = 6.8
Identities = 20/76 (26%), Positives = 41/76 (53%)
Frame = -1

Query: 266 LSRNGSQIMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIK 87
LSR SQ+ + ++K+ Y + + +KI+ + FLA + I + T SGAE+I
Sbjct: 202 LSRKISQLNNDLIKKYIYVYTTSDLGKKIM-LNHFLATKGIYINKDKIVAITESGAETIN 260

Query: 86 DAIFQLCRHPDTEVQN 39
+ +++ + +++ N
Sbjct: 261 NLVYKYMKIKESDQTN 276


>sp|Q8CJ11|GPR64_RAT G-protein coupled receptor 64 OS=Rattus
norvegicus GN=Gpr64 PE=2 SV=1
Length = 1013

Score = 30.0 bits (66), Expect = 6.8
Identities = 17/38 (44%), Positives = 22/38 (57%)
Frame = +1

Query: 268 TSKRIALDWVFSNASNTNERSLVLFDPSPLDVSLEEKA 381
TS +AL + NASN N + DP+ L VSLE +A
Sbjct: 440 TSPSLALAVIRVNASNFNTTTFAAQDPANLQVSLEAQA 477


>sp|Q8IZP9|GPR64_HUMAN G-protein coupled receptor 64 OS=Homo sapiens
GN=GPR64 PE=1 SV=1
Length = 1017

Score = 29.6 bits (65), Expect = 8.8
Identities = 17/38 (44%), Positives = 23/38 (60%)
Frame = +1

Query: 268 TSKRIALDWVFSNASNTNERSLVLFDPSPLDVSLEEKA 381
TS +AL + NAS+ N + V DP+ L VSLE +A
Sbjct: 444 TSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQA 481


tr_hit_id A9RU55
Definition tr|A9RU55|A9RU55_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 157
Score (bit) 131.0
E-value 2.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921729|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_E01.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RU55|A9RU55_PHYPA Predicted protein OS=Physcomitrella paten... 131 2e-29
tr|A3A7Y5|A3A7Y5_ORYSJ Putative uncharacterized protein OS=Oryza... 129 1e-28
tr|A9QA57|A9QA57_ARATH SDG8 OS=Arabidopsis thaliana PE=2 SV=1 127 4e-28
tr|A7NVJ0|A7NVJ0_VITVI Chromosome chr18 scaffold_1, whole genome... 127 4e-28
tr|B8AJE9|B8AJE9_ORYSI Putative uncharacterized protein OS=Oryza... 115 1e-24
tr|A9T8D5|A9T8D5_PHYPA Predicted protein OS=Physcomitrella paten... 113 5e-24
tr|Q69SU4|Q69SU4_ORYSJ Os02g0554000 protein OS=Oryza sativa subs... 93 9e-18
tr|B4FHC8|B4FHC8_MAIZE Putative uncharacterized protein OS=Zea m... 76 9e-13
tr|Q69SU3|Q69SU3_ORYSJ Putative uncharacterized protein P0470G10... 75 3e-12
tr|A8J069|A8J069_CHLRE Histone methyltransferase OS=Chlamydomona... 35 2.2
tr|A8PM49|A8PM49_BRUMA Excretory/secretory protein Juv-p120, put... 35 2.9

>tr|A9RU55|A9RU55_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=SDG1547 PE=4 SV=1
Length = 1715

Score = 131 bits (330), Expect = 2e-29
Identities = 75/157 (47%), Positives = 102/157 (64%)
Frame = -1

Query: 479 VEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDALL 300
VEE+L +L +E GGL K Q + A YLKLLV TA RDLS++L+ALL
Sbjct: 1004 VEEKLGELTNEFGGLRK-QKDAAKQYLKLLVLTAASGGNVNGAAACSSARDLSMLLEALL 1062

Query: 299 KTQSRAILLEVLSRNGSQIMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINA 120
KTQ ++L +++ +NG Q+ H ++KQ R +++ PI+RK+LKVL+ LA RR+LT+E I
Sbjct: 1063 KTQKSSLLKDIMDKNGLQMFHNLLKQFRKSFEKRPILRKLLKVLDHLAKRRVLTVEHI-F 1121

Query: 119 EPTRSGAESIKDAIFQLCRHPDTEVQNMAPPF*RKIF 9
P RSG E D +F L RH D EVQNMA F RK++
Sbjct: 1122 SPPRSGNECFSDTLFDLSRHDDMEVQNMARNF-RKLY 1157


>tr|A3A7Y5|A3A7Y5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_006907 PE=4 SV=1
Length = 1994

Score = 129 bits (323), Expect = 1e-28
Identities = 70/152 (46%), Positives = 101/152 (66%)
Frame = -1

Query: 479 VEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDALL 300
VE L+ L+D NGG+ K + + YLKLL+ TA RDLSL+LDALL
Sbjct: 1582 VEGRLNSLLDVNGGISKRK-DATNGYLKLLLVTA--AEGDNAGGTSKSVRDLSLILDALL 1638

Query: 299 KTQSRAILLEVLSRNGSQIMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINA 120
KT+S ++LL+++++NG Q++H I+KQ++ D+ R PIIRK++KVLEFLA + ILT E IN
Sbjct: 1639 KTRSNSVLLDIINKNGLQMLHNILKQNKSDFHRIPIIRKLVKVLEFLASKGILTSEHING 1698

Query: 119 EPTRSGAESIKDAIFQLCRHPDTEVQNMAPPF 24
P +G ES ++++ L RH D +VQ +A F
Sbjct: 1699 GPRCAGTESFRESMLGLLRHNDMQVQQIARNF 1730


>tr|A9QA57|A9QA57_ARATH SDG8 OS=Arabidopsis thaliana PE=2 SV=1
Length = 1805

Score = 127 bits (318), Expect = 4e-28
Identities = 69/154 (44%), Positives = 101/154 (65%)
Frame = -1

Query: 485 EGVEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDA 306
E E +L++L+D GG+ K + + A YLKLL+ TA RDLS++LDA
Sbjct: 1373 ETFEGKLNELLDAVGGISKRR-DSAKGYLKLLLLTA--ASRGTDEEGIYSNRDLSMILDA 1429

Query: 305 LLKTQSRAILLEVLSRNGSQIMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQI 126
LLKT+S+++L++++++NG Q++H I+KQ R D+KR PIIRK+LKVLE+LA R+IL +E I
Sbjct: 1430 LLKTKSKSVLVDIINKNGLQMLHNIMKQYRGDFKRIPIIRKLLKVLEYLATRKILALEHI 1489

Query: 125 NAEPTRSGAESIKDAIFQLCRHPDTEVQNMAPPF 24
P +G ES KD++ H D V N+A F
Sbjct: 1490 IRRPPFAGMESFKDSVLSFTEHDDYTVHNIARSF 1523


>tr|A7NVJ0|A7NVJ0_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015453001
PE=4 SV=1
Length = 1611

Score = 127 bits (318), Expect = 4e-28
Identities = 67/155 (43%), Positives = 104/155 (67%)
Frame = -1

Query: 488 FEGVEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLD 309
FE V+E+L++L+D NGG+ K + + + YLKLL+ T TRDLS++LD
Sbjct: 1041 FEAVQEKLNELLDANGGISKRK-DSSKGYLKLLLLTV-ASGDNGNREAIQSTRDLSMILD 1098

Query: 308 ALLKTQSRAILLEVLSRNGSQIMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQ 129
ALLKT+SR +L+++L++NG +++H I+KQ ++ + P++RK+LKVLE+LA+R ILT+E
Sbjct: 1099 ALLKTKSRVVLVDILNKNGLRMLHNIMKQYSREFIKIPVLRKLLKVLEYLALRGILTLEH 1158

Query: 128 INAEPTRSGAESIKDAIFQLCRHPDTEVQNMAPPF 24
IN P G ES +D++ L H D +V +A F
Sbjct: 1159 INGGPPCPGMESFRDSMLTLTEHNDKQVHQIARSF 1193


>tr|B8AJE9|B8AJE9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07633 PE=4 SV=1
Length = 1906

Score = 115 bits (289), Expect = 1e-24
Identities = 61/132 (46%), Positives = 88/132 (66%)
Frame = -1

Query: 419 EVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDALLKTQSRAILLEVLSRNGSQIM 240
+ YLKLL+ TA RDLSL+LDALLKT+S ++LL+++++NG Q++
Sbjct: 1532 DATNGYLKLLLVTA--AEGDNAGGTSKSVRDLSLILDALLKTRSNSVLLDIINKNGLQML 1589

Query: 239 HKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIKDAIFQLCRH 60
H I+KQ++ D+ R PIIRK++KVLEFLA + ILT E IN P +G ES ++++ L RH
Sbjct: 1590 HNILKQNKSDFHRIPIIRKLVKVLEFLASKGILTSEHINGGPRCAGTESFRESMLGLLRH 1649

Query: 59 PDTEVQNMAPPF 24
D +VQ +A F
Sbjct: 1650 NDMQVQQIARNF 1661


>tr|A9T8D5|A9T8D5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=SDG1517 PE=4 SV=1
Length = 1980

Score = 113 bits (283), Expect = 5e-24
Identities = 62/132 (46%), Positives = 87/132 (65%)
Frame = -1

Query: 404 YLKLLVRTAFXXXXXXXXXXXXXTRDLSLVLDALLKTQSRAILLEVLSRNGSQIMHKIVK 225
YLKLLV TA RDLS++L+ALLKTQ ++L +++++NG Q+ H ++K
Sbjct: 1282 YLKLLVLTA-ASGGSVNGAAACSARDLSMLLEALLKTQKLSLLKDIMNKNGLQMFHNLLK 1340

Query: 224 QSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIKDAIFQLCRHPDTEV 45
Q R +++ PI+RK+LKVL++LA R+LT+E I P RSG E D +F L RH D EV
Sbjct: 1341 QFRKSFEKRPILRKLLKVLDYLAKNRVLTVEHI-FSPPRSGTECFSDTLFDLSRHDDMEV 1399

Query: 44 QNMAPPF*RKIF 9
QNMA F RK++
Sbjct: 1400 QNMARTF-RKLY 1410


>tr|Q69SU4|Q69SU4_ORYSJ Os02g0554000 protein OS=Oryza sativa subsp.
japonica GN=P0470G10.13 PE=4 SV=1
Length = 637

Score = 92.8 bits (229), Expect = 9e-18
Identities = 49/107 (45%), Positives = 72/107 (67%)
Frame = -1

Query: 491 HFEGVEEELHKLIDENGGLCKSQPEVATSYLKLLVRTAFXXXXXXXXXXXXXTRDLSLVL 312
H GVE L+ L+D NGG+ K + + YLKLL+ TA RDLSL+L
Sbjct: 523 HILGVEGRLNSLLDVNGGISKRK-DATNGYLKLLLVTA--AEGDNAGGTSKSVRDLSLIL 579

Query: 311 DALLKTQSRAILLEVLSRNGSQIMHKIVKQSRMDYKRTPIIRKILKV 171
DALLKT+S ++LL+++++NG Q++H I+KQ++ D+ R PIIRK++KV
Sbjct: 580 DALLKTRSNSVLLDIINKNGLQMLHNILKQNKSDFHRIPIIRKLVKV 626


>tr|B4FHC8|B4FHC8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 340

Score = 76.3 bits (186), Expect = 9e-13
Identities = 39/74 (52%), Positives = 50/74 (67%)
Frame = -1

Query: 245 IMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIKDAIFQLC 66
++H I+KQSR + R PIIRK+LKVLEFLA + ILT E IN P +G ES +D + L
Sbjct: 1 MLHNILKQSRGIFHRRPIIRKLLKVLEFLAQKGILTSEHINGGPRFAGVESFRDLMLSLT 60

Query: 65 RHPDTEVQNMAPPF 24
RH D +VQ +A F
Sbjct: 61 RHSDIQVQQIARSF 74


>tr|Q69SU3|Q69SU3_ORYSJ Putative uncharacterized protein P0470G10.14
OS=Oryza sativa subsp. japonica GN=P0470G10.14 PE=4 SV=1
Length = 334

Score = 74.7 bits (182), Expect = 3e-12
Identities = 36/74 (48%), Positives = 52/74 (70%)
Frame = -1

Query: 245 IMHKIVKQSRMDYKRTPIIRKILKVLEFLAVRRILTIEQINAEPTRSGAESIKDAIFQLC 66
++H I+KQ++ D+ R PIIRK++KVLEFLA + ILT E IN P +G ES ++++ L
Sbjct: 1 MLHNILKQNKSDFHRIPIIRKLVKVLEFLASKGILTSEHINGGPRCAGTESFRESMLGLL 60

Query: 65 RHPDTEVQNMAPPF 24
RH D +VQ +A F
Sbjct: 61 RHNDMQVQQIARNF 74


>tr|A8J069|A8J069_CHLRE Histone methyltransferase OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_191388 PE=4 SV=1
Length = 1105

Score = 35.0 bits (79), Expect = 2.2
Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 1/106 (0%)
Frame = -1

Query: 329 DLSLVLDALLKTQSRAILLEVLSRNGSQIMHKIV-KQSRMDYKRTPIIRKILKVLEFLAV 153
DLSL+LD +LKT S A + ++ +H+ + + + +Y I+RK+L+V+E
Sbjct: 714 DLSLLLDVVLKTTSSAAKKDFVTCGLLTQLHQAMGRNTGKEY--CVILRKVLRVVE---- 767

Query: 152 RRILTIEQINAEPTRSGAESIKDAIFQLCRHPDTEVQNMAPPF*RK 15
L +E + RS + D + QL + D +V+ A +K
Sbjct: 768 --ALPLEANDVYSVRSAHGNFADMLRQLSTNADYDVRTKAAALLKK 811