BP921738
Clone id YMU001_000153_E10
Library
Length 553
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AAGAAGGAGCTGGCCCAGTTGTACTTTCTTCCATAGTCACTTCAGGTGGGGGTGCTTCTT
GTGTTGGAGGCGCTCGAGGAGGTATTGTATCGCTTCTTATAGTAATTCTTTTTGATGGTC
CTTCATCACCACTCTCTCGCTTGCGCTTTTCTTCCACAAAAGCTTCGTTGTTTTGACATT
TTGCAATATAGGCATGCACTGACAAGGAGTCCACAGGATTATTCCATCCTTTTTCTAGAC
GAATACAGTCACCTGCTTCATGTAGGACTTCTCTTGTAAGCTTTCCTTTCCTTGCTAGCT
CCATAGCACTTGGCCACAACTTACCATTTTCTTCAAAACTCCTCAATGGTTCAATATTGA
TTGTATAAGTAGATGCCTCAGATGCAGAGATGGCATGGGTAGTGGCCATATCCTCTACCA
GACTCTGCATTTCTCCTTTCCCAAAGTTAGTCCTTAAGGGTAAATCTGTCTCCCTTAAGT
GAATCTTCCCATCCTTGAAGAAGACAAGATCTGTTCTCAAAGCTTCATTGAAGCTGTCAC
ATTCTCTCCTTTT
■■Homology search results ■■ -
sp_hit_id Q8FPB3
Definition sp|Q8FPB3|TRUB_COREF tRNA pseudouridine synthase B OS=Corynebacterium efficiens
Align length 119
Score (bit) 36.2
E-value 0.11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921738|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_E10.
(553 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8FPB3|TRUB_COREF tRNA pseudouridine synthase B OS=Corynebact... 36 0.11
sp|Q8R7N1|SYK_THETN Lysyl-tRNA synthetase OS=Thermoanaerobacter ... 36 0.14
sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase OS=Schizos... 32 2.1
sp|Q8NP46|TRUB_CORGL tRNA pseudouridine synthase B OS=Corynebact... 32 2.7
sp|Q21JG6|SYC_SACD2 Cysteinyl-tRNA synthetase OS=Saccharophagus ... 32 2.7
sp|A4QEY6|TRUB_CORGB tRNA pseudouridine synthase B OS=Corynebact... 31 3.5
sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B' OS=... 31 3.5
sp|Q54M18|ARG56_DICDI Bifunctional protein argC, mitochondrial O... 31 4.6
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans... 30 7.9

>sp|Q8FPB3|TRUB_COREF tRNA pseudouridine synthase B
OS=Corynebacterium efficiens GN=truB PE=3 SV=2
Length = 297

Score = 36.2 bits (82), Expect = 0.11
Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 9/119 (7%)
Frame = -1

Query: 466 DLPLRTNFGKGE-MQSLVEDMATT-------HAISASEASTYTI-NIEPLRSFEENGKLW 314
DL +R + G ++SL D+ A+ +E +T+ + PL ++N +L
Sbjct: 168 DLDVRVHCSSGTYIRSLARDLGAALGVGGHLTALRRTEVGPFTLEDAIPLADLQDNARLS 227

Query: 313 PSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVHAYIAKCQNNEAFVEEKRKR 137
S E + E+ G+ + + K W P VHA + + A VEEK KR
Sbjct: 228 LSLDEALARSYPVLEITEAEGEALSMGK-WLEPRGLKGVHAAVTPSGRSIALVEEKGKR 285


>sp|Q8R7N1|SYK_THETN Lysyl-tRNA synthetase OS=Thermoanaerobacter
tengcongensis GN=lysS PE=3 SV=1
Length = 499

Score = 35.8 bits (81), Expect = 0.14
Identities = 30/126 (23%), Positives = 52/126 (41%), Gaps = 1/126 (0%)
Frame = -1

Query: 496 KDGKIHLRETDLPLRTNFGKGEMQSLV-EDMATTHAISASEASTYTINIEPLRSFEENGK 320
KD + L++ D+ KGE+ +LV +++ H I + Y + + PL + +
Sbjct: 349 KDLNLELKKPDMK------KGEVIALVFDELVEKHLIQPTFVMDYPVEVSPLAKRKRDNP 402

Query: 319 LWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVHAYIAKCQNNEAFVEEKRK 140
+ S E G+ E N+P+D E F+E+ R+
Sbjct: 403 AFTSRFEAFIYGREVANAFSEL----------NDPIDQ------------KERFLEQLRQ 440

Query: 139 RESGDE 122
RE+GDE
Sbjct: 441 REAGDE 446


>sp|P50514|ARLZ_SCHPO Probable argininosuccinate lyase
OS=Schizosaccharomyces pombe GN=argx PE=2 SV=1
Length = 460

Score = 32.0 bits (71), Expect = 2.1
Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 11/87 (12%)
Frame = -1

Query: 373 STYTINIEPL-RSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSV 197
ST T+N E + +S + A L RKG RE H +G +R+ + N +D LSV
Sbjct: 351 STLTVNPENIAKSLTADMLATDLAEYLVRKGVPFRETHHISGSAVRMAEERNTTIDKLSV 410

Query: 196 HAY----------IAKCQNNEAFVEEK 146
+ +A N E+ VE++
Sbjct: 411 EDFKSLHPLYEEDVADVFNYESSVEKR 437


>sp|Q8NP46|TRUB_CORGL tRNA pseudouridine synthase B
OS=Corynebacterium glutamicum GN=truB PE=3 SV=1
Length = 297

Score = 31.6 bits (70), Expect = 2.7
Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 9/133 (6%)
Frame = -1

Query: 508 LVFFKDGKIHLRETDLPLRTNFGKGE-MQSLVEDMATT-------HAISASEASTYTIN- 356
L + DG+ + DL +R + G +++L D+ A+ +E +T+N
Sbjct: 158 LDYHVDGEFY----DLDVRVHCSSGTYIRALARDLGNALQVGGHLTALRRTEVGPFTLND 213

Query: 355 IEPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVHAYIAKC 176
PL +EN +L + + + ++ + G + + K W P VHA +
Sbjct: 214 ATPLSKLQENPELSLNLDQALTRSYPVLDITEDEGVDLSMGK-WLEPRGLKGVHAAVTPS 272

Query: 175 QNNEAFVEEKRKR 137
A +EEK KR
Sbjct: 273 GKAVALIEEKGKR 285


>sp|Q21JG6|SYC_SACD2 Cysteinyl-tRNA synthetase OS=Saccharophagus
degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysS
PE=3 SV=1
Length = 459

Score = 31.6 bits (70), Expect = 2.7
Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 11/76 (14%)
Frame = -1

Query: 427 QSLVEDMATTHAISASEASTYTINIEPL-----------RSFEENGKLWPSAMELARKGK 281
++ +EDMA H + S A T +IEP+ ++E +G + + GK
Sbjct: 95 EAYIEDMAALHNLPPSIAPKATAHIEPMIAMVAALVEKGHAYEADGHVLFDVQSMKNYGK 154

Query: 280 LTREVLHEAGDCIRLE 233
L+ L + D R+E
Sbjct: 155 LSNRALEDMLDGARVE 170


>sp|A4QEY6|TRUB_CORGB tRNA pseudouridine synthase B
OS=Corynebacterium glutamicum (strain R) GN=truB PE=3
SV=1
Length = 297

Score = 31.2 bits (69), Expect = 3.5
Identities = 28/119 (23%), Positives = 50/119 (42%), Gaps = 9/119 (7%)
Frame = -1

Query: 466 DLPLRTNFGKGE-MQSLVEDMATT-------HAISASEASTYTIN-IEPLRSFEENGKLW 314
DL +R + G +++L D+ A+ +E +T+N PL +EN +L
Sbjct: 168 DLDVRVHCSSGTYIRALARDLGNALQVGGHLTALRRTEVGPFTLNDATPLSKLQENPELS 227

Query: 313 PSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVHAYIAKCQNNEAFVEEKRKR 137
+ + + ++ + G + + K W P VHA + A +EEK KR
Sbjct: 228 LNLDQALTRSYPVLDITEDEGVDLSMGK-WLEPRGLKGVHAAVTPSGKAVALIEEKGKR 285


>sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B'
OS=Methanobacterium thermoautotrophicum GN=rpoB1 PE=3
SV=1
Length = 603

Score = 31.2 bits (69), Expect = 3.5
Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
Frame = -1

Query: 187 IAKCQNNEAFVEE-KRKRESGDEGPSKRIT 101
I C+N E FVEE ++KR SG+ P IT
Sbjct: 13 IGTCENPEEFVEEMRKKRRSGEVSPEMNIT 42


>sp|Q54M18|ARG56_DICDI Bifunctional protein argC, mitochondrial
OS=Dictyostelium discoideum GN=argC PE=3 SV=1
Length = 847

Score = 30.8 bits (68), Expect = 4.6
Identities = 25/98 (25%), Positives = 36/98 (36%), Gaps = 12/98 (12%)
Frame = -2

Query: 366 IQSILNH*GVLKKMVSCGQVLWS*QGKESLQEKSYMKQVTVFV*KKDGIILWTPCQCMPI 187
IQS + V KKM +W L + + K T F+ I WT I
Sbjct: 433 IQSTEDSESVFKKMFENSSYIWKESSNNQLNNEWFKKIATGFITGATNNIFWTNIDTNKI 492

Query: 186 LQNVK------------TTKLLWKKSASERVVMKDHQK 109
++K TK KSASE+++ + K
Sbjct: 493 ENSIKECLSQSSTYLSGITKAASSKSASEKLLQDKNHK 530


>sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans
GN=PHR1 PE=2 SV=2
Length = 548

Score = 30.0 bits (66), Expect = 7.9
Identities = 21/59 (35%), Positives = 28/59 (47%)
Frame = +2

Query: 209 VHRIIPSFF*TNTVTCFM*DFSCKLSFPC*LHSTWPQLTIFFKTPQWFNIDCISRCLRC 385
+++I PS T+T++ D S L P STW T TP DCIS+ L C
Sbjct: 334 MNKISPSLAHTSTLSSS--DASKTLQCPGTAASTWKAATNLPPTPDESYCDCISKSLEC 390


tr_hit_id A9TC30
Definition tr|A9TC30|A9TC30_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 157
Score (bit) 134.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921738|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_E10.
(553 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TC30|A9TC30_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A9RID4|A9RID4_PHYPA Predicted protein OS=Physcomitrella paten... 129 8e-29
tr|A9TK13|A9TK13_PHYPA Predicted protein OS=Physcomitrella paten... 120 6e-26
tr|A9TK11|A9TK11_PHYPA Predicted protein OS=Physcomitrella paten... 120 6e-26
tr|A9S3S2|A9S3S2_PHYPA Predicted protein OS=Physcomitrella paten... 120 6e-26
tr|A9TCZ6|A9TCZ6_PHYPA Predicted protein OS=Physcomitrella paten... 119 1e-25
tr|A9SQ03|A9SQ03_PHYPA Predicted protein OS=Physcomitrella paten... 119 1e-25
tr|A9RRW4|A9RRW4_PHYPA Predicted protein OS=Physcomitrella paten... 119 1e-25
tr|A9ST07|A9ST07_PHYPA Predicted protein OS=Physcomitrella paten... 119 1e-25
tr|A9RD60|A9RD60_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9U5L6|A9U5L6_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9U2E1|A9U2E1_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9TXZ9|A9TXZ9_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9S2J2|A9S2J2_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9RTQ9|A9RTQ9_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A9U569|A9U569_PHYPA Predicted protein OS=Physcomitrella paten... 117 3e-25
tr|A9TXN1|A9TXN1_PHYPA Predicted protein OS=Physcomitrella paten... 117 3e-25
tr|A9TSB6|A9TSB6_PHYPA Predicted protein OS=Physcomitrella paten... 117 3e-25
tr|A9T8S7|A9T8S7_PHYPA Predicted protein OS=Physcomitrella paten... 117 3e-25
tr|A9T403|A9T403_PHYPA Predicted protein OS=Physcomitrella paten... 117 3e-25
tr|A9U600|A9U600_PHYPA Predicted protein (Fragment) OS=Physcomit... 117 4e-25
tr|A9U5P9|A9U5P9_PHYPA Predicted protein (Fragment) OS=Physcomit... 117 4e-25
tr|A9U1B4|A9U1B4_PHYPA Predicted protein OS=Physcomitrella paten... 117 4e-25
tr|A9TXN8|A9TXN8_PHYPA Predicted protein OS=Physcomitrella paten... 117 4e-25
tr|A9STQ8|A9STQ8_PHYPA Predicted protein OS=Physcomitrella paten... 117 4e-25
tr|A9TWC7|A9TWC7_PHYPA Predicted protein OS=Physcomitrella paten... 117 5e-25
tr|A9T9L9|A9T9L9_PHYPA Predicted protein OS=Physcomitrella paten... 117 5e-25
tr|A9TXZ7|A9TXZ7_PHYPA Predicted protein OS=Physcomitrella paten... 116 7e-25
tr|A9TSB7|A9TSB7_PHYPA Predicted protein OS=Physcomitrella paten... 116 7e-25
tr|A9TFR1|A9TFR1_PHYPA Predicted protein OS=Physcomitrella paten... 116 7e-25

>tr|A9TC30|A9TC30_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_90813 PE=4 SV=1
Length = 423

Score = 134 bits (337), Expect = 3e-30
Identities = 74/157 (47%), Positives = 95/157 (60%), Gaps = 7/157 (4%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
RREC+ F EAL +VFFKDG +H +E L TNFGKG M+ + D IS++EAS
Sbjct: 229 RRECEEFTEALCKGVVFFKDGMMHSKENGEKLETNFGKGGMKLFIGDTFKVQTISSNEAS 288

Query: 370 TYTINIEPLRSFE-------ENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPV 212
TY + + R E+ LW SAM + TR+ L G+ IR GW++PV
Sbjct: 289 TYWVEADTRRCLSINLEFPIESSSLWTSAMRYIERRNFTRDDLKHVGNNIRKIIGWDDPV 348

Query: 211 DSLSVHAYIAKCQNNEAFVEEKRKRESGDEGPSKRIT 101
D LSVHA+IA+ Q +EA VEEKR+R +EGPSKRIT
Sbjct: 349 DRLSVHAHIARNQ-HEALVEEKRRRNENNEGPSKRIT 384


>tr|A9RID4|A9RID4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_66531 PE=4 SV=1
Length = 396

Score = 129 bits (325), Expect = 8e-29
Identities = 68/157 (43%), Positives = 93/157 (59%), Gaps = 7/157 (4%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R+EC+ F EAL VF KDG +H +E L NFGKG ++ + D IS++EAS
Sbjct: 18 RKECEEFTEALHKGFVFLKDGMLHSKENGEKLEINFGKGRIKLFIGDTFKVQTISSNEAS 77

Query: 370 TYTINIEPLRSFE-------ENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPV 212
TY + +P R E+ LW SAM A + R+ L G+ IR GW+NPV
Sbjct: 78 TYWVEADPSRYLSINLEFPVESSSLWISAMRYAERRNFIRDDLKRIGNNIRQITGWDNPV 137

Query: 211 DSLSVHAYIAKCQNNEAFVEEKRKRESGDEGPSKRIT 101
+ LSVH +IA+ Q +EA +EEKR+++ +EGPSKRIT
Sbjct: 138 ERLSVHVHIARSQ-HEALIEEKRRKDENNEGPSKRIT 173


>tr|A9TK13|A9TK13_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93767 PE=4 SV=1
Length = 1044

Score = 120 bits (300), Expect = 6e-26
Identities = 70/181 (38%), Positives = 101/181 (55%), Gaps = 3/181 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ D +TNFGKG M++LV+D H A E++
Sbjct: 441 RKDCNEFNNMIRQRIICWKDGKIALKDRDDVFQTNFGKGRMRALVQDYLKEHETVARESA 500

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + + E + W A+ +KGKL REVL IR GW +PV+SLSVH
Sbjct: 501 SYGARVDDEIGGSTETSEFWTFAVSTMQKGKLPREVLLGTAAIIRGRIGWEDPVESLSVH 560

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSDTIXXXXXXXXXXXXXEVTMEEST 20
AYIAK Q +EA +EEKR+ D EG S + R D +++EE T
Sbjct: 561 AYIAKSQ-HEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSISLEEKT 619

Query: 19 T 17
T
Sbjct: 620 T 620


>tr|A9TK11|A9TK11_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93765 PE=4 SV=1
Length = 1094

Score = 120 bits (300), Expect = 6e-26
Identities = 70/181 (38%), Positives = 101/181 (55%), Gaps = 3/181 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ D +TNFGKG M++LV+D H A E++
Sbjct: 419 RKDCNEFNNMIRQRIICWKDGKIALKDRDDVFQTNFGKGRMRALVQDYLKEHETVARESA 478

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + + E + W A+ +KGKL REVL IR GW +PV+SLSVH
Sbjct: 479 SYGARVDDEIGGSTETSEFWTFAVSTMQKGKLPREVLLGTAAIIRGRIGWEDPVESLSVH 538

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSDTIXXXXXXXXXXXXXEVTMEEST 20
AYIAK Q +EA +EEKR+ D EG S + R D +++EE T
Sbjct: 539 AYIAKSQ-HEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSISLEEKT 597

Query: 19 T 17
T
Sbjct: 598 T 598


>tr|A9S3S2|A9S3S2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_74185 PE=4 SV=1
Length = 614

Score = 120 bits (300), Expect = 6e-26
Identities = 67/157 (42%), Positives = 97/157 (61%), Gaps = 3/157 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKG M++LV+D H A E++
Sbjct: 254 RKDCNEFNNMIRQGIICWKDGKIILKDREDLLQTNFGKGGMRALVQDYLKGHETVARESA 313

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y I + + + E + W SA+ ++GKL RE L IR GW +PV+SLSVH
Sbjct: 314 SYGIRVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVH 373

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSD 89
AYIAK Q +EA +EEKR+R D EG S + R D
Sbjct: 374 AYIAKSQ-HEALMEEKRRRNFDDTREGNSFKRQTRGD 409


>tr|A9TCZ6|A9TCZ6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_91146 PE=4 SV=1
Length = 881

Score = 119 bits (298), Expect = 1e-25
Identities = 68/180 (37%), Positives = 101/180 (56%), Gaps = 3/180 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKGEM++L++D H +A E+
Sbjct: 352 RKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGEMRALIQDNLKEHETAARESI 411

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + E + W SA+ ++G L R+VL IR GW +PV+SLSVH
Sbjct: 412 SYGARVDDDFGGRTETSEFWASAISTMQEGNLPRKVLLRTAATIRGAIGWEDPVESLSVH 471

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSDTIXXXXXXXXXXXXXEVTMEEST 20
AYIAK Q +EA +EEKR+R D EG S + R D ++EE T
Sbjct: 472 AYIAKSQ-HEALIEEKRRRNFDDMKEGNSSKRQTRGDKAREAASQELLIKDISASLEEKT 530


>tr|A9SQ03|A9SQ03_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_82369 PE=4 SV=1
Length = 709

Score = 119 bits (298), Expect = 1e-25
Identities = 68/181 (37%), Positives = 103/181 (56%), Gaps = 3/181 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKGEM++L++D H A E++
Sbjct: 205 RKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGEMRALIQDYLKEHETVAREST 264

Query: 370 TYTINIE-PLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y ++ L E + W SA+ ++ KL REVL + +R GW +PV+SLS+H
Sbjct: 265 SYGARVDNDLGGSTETSEFWASAISTMQERKLPREVLLKTTATVRGAIGWKDPVESLSIH 324

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSDTIXXXXXXXXXXXXXEVTMEEST 20
AYIAK Q +EA +EEKR+ D EG S + R D ++EE T
Sbjct: 325 AYIAKSQ-HEALMEEKRRGNFDDTREGNSSKRQTRGDKAREAASQELRVKDTSTSLEEKT 383

Query: 19 T 17
T
Sbjct: 384 T 384


>tr|A9RRW4|A9RRW4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_69625 PE=4 SV=1
Length = 899

Score = 119 bits (298), Expect = 1e-25
Identities = 71/181 (39%), Positives = 103/181 (56%), Gaps = 3/181 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKG M++LV+D H +A E++
Sbjct: 266 RKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHKKAAQESA 325

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + L E + W SA+ ++ KL REVL IR GW +PV+SLSVH
Sbjct: 326 SYGARVDDDLGGSTETSEFWASAISTMQEEKLPREVLLRIAATIRGATGWKDPVESLSVH 385

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSDTIXXXXXXXXXXXXXEVTMEEST 20
AYIAK Q +EA +EEKR+ D EG S + IR D ++EE T
Sbjct: 386 AYIAKGQ-HEALMEEKRRGNFDDTREGNSFKRQIRGDKAREAASQELPVKDTLASLEEKT 444

Query: 19 T 17
T
Sbjct: 445 T 445


>tr|A9ST07|A9ST07_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_83605 PE=4 SV=1
Length = 548

Score = 119 bits (297), Expect = 1e-25
Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 3/157 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKG M++LV+D H +A E++
Sbjct: 309 RKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGRMRALVQDYLKEHETAAREST 368

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + L + + W SA+ ++GKL RE L IR GW +PV+SLSVH
Sbjct: 369 SYGARVDDDLGRNMKTSEFWASAISTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVH 428

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSD 89
AYIAK Q +EA +EEKR+ D EG S + R D
Sbjct: 429 AYIAKSQ-HEALIEEKRRENFDDTREGNSSKRQTRGD 464


>tr|A9RD60|A9RD60_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64344 PE=4 SV=1
Length = 709

Score = 118 bits (296), Expect = 2e-25
Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 3/157 (1%)
Frame = -1

Query: 550 RRECDSFNEALRTDLVFFKDGKIHLRETDLPLRTNFGKGEMQSLVEDMATTHAISASEAS 371
R++C+ FN +R ++ +KDGKI L++ + L+TNFGKG M++LV+D H A E++
Sbjct: 51 RKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVARESA 110

Query: 370 TYTINI-EPLRSFEENGKLWPSAMELARKGKLTREVLHEAGDCIRLEKGWNNPVDSLSVH 194
+Y + + + E + W SA+ ++GKL RE L IR W +PV+SLSVH
Sbjct: 111 SYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTDWEDPVESLSVH 170

Query: 193 AYIAKCQNNEAFVEEKRKRESGD--EGPSKRITIRSD 89
AYIAK Q +EA +EEKR+R S D EG S + R D
Sbjct: 171 AYIAKSQ-HEALMEEKRRRNSDDTREGNSFKRQTRGD 206