BP921749
Clone id YMU001_000153_G02
Library
Length 466
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGAGAAAAGCGCATGCTTTGCTATTACCTCAAACCTGTGACCAGCTTGAGAAAGTCTCGA
TATCTGACTTTTACTCAAGTCCAAGACAACAACCTTACTGAGTGTAAGCTGAGAAGGAAG
AAACTTAAGGGGACTGAAACCATCTGAGCTCCTCGGGAAACAAGCTGAAATCCCCTGTGA
TGTGGCCATTCCCAGATAGCACTAGAAACCGTAGAGAATCCATGCCAGCAAAAGTCTTTA
CACCCCATTCCTCCCCATTCCTCCAAAGTCAAAAGCTCTACCCCACGCACCAAACTTGTT
CCCTACAGCACTCCGCAATATCAGTACTAACATGTCACATGGACAAACACACAACCTGAC
ACCAATTTTACCTTTCCACGTTCCAGAACAACACGCACATCATCCTCATTCCACAAATGG
CTACGATCGACCACTATTTCTCGCCCCATATCCCAAAGAAGGTCGT
■■Homology search results ■■ -
sp_hit_id Q09345
Definition sp|Q09345|YRR2_CAEEL Uncharacterized protein R144.2 OS=Caenorhabditis elegans
Align length 108
Score (bit) 35.8
E-value 0.095
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921749|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G02.
(466 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09345|YRR2_CAEEL Uncharacterized protein R144.2 OS=Caenorhab... 36 0.095
sp|Q54EQ9|Y1586_DICDI Putative uncharacterized protein DDB_G0291... 34 0.36
sp|Q14CM0|FRPD4_HUMAN FERM and PDZ domain-containing protein 4 O... 33 0.62
sp|A6NL88|U626A_HUMAN UPF0626 protein A OS=Homo sapiens PE=2 SV=2 32 1.4
sp|A7XYJ6|SOBPB_DANRE Sine oculis-binding protein homolog OS=Dan... 32 1.4
sp|Q10669|MED23_CAEEL Mediator of RNA polymerase II transcriptio... 32 1.8
sp|Q6NZ22|K1627_DANRE Methyltransferase-like protein KIAA1627 ho... 32 1.8
sp|Q8C3Q5|U626A_MOUSE UPF0626 protein A OS=Mus musculus PE=1 SV=2 32 1.8
sp|Q569H4|PRR16_HUMAN Proline-rich protein 16 OS=Homo sapiens GN... 31 2.3
sp|Q63410|OTX1_RAT Homeobox protein OTX1 OS=Rattus norvegicus GN... 31 2.3
sp|P80205|OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus GN=Ot... 31 2.3
sp|P32242|OTX1_HUMAN Homeobox protein OTX1 OS=Homo sapiens GN=OT... 31 2.3
sp|Q1DKE6|IRS4_COCIM Increased rDNA silencing protein 4 OS=Cocci... 31 2.3
sp|Q9VLP7|K1627_DROME Methyltransferase-like protein KIAA1627 ho... 31 3.0
sp|A2AFR3|FRPD4_MOUSE FERM and PDZ domain-containing protein 4 O... 31 3.1
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos ... 30 5.1
sp|Q28640|HRG_RABIT Histidine-rich glycoprotein (Fragment) OS=Or... 30 5.2

>sp|Q09345|YRR2_CAEEL Uncharacterized protein R144.2
OS=Caenorhabditis elegans GN=R144.2 PE=2 SV=1
Length = 823

Score = 35.8 bits (81), Expect = 0.095
Identities = 32/108 (29%), Positives = 39/108 (36%), Gaps = 11/108 (10%)
Frame = +2

Query: 134 LKPSELLGKQAEIPCDVAIPR*H*KP*RIHASKSLYTPFLPIPPKSKALP------HAPN 295
LKP+ ++G A P I +P PF+P PP S A P H P
Sbjct: 300 LKPTSVIGSHAFAPVAAPI-----RPMIPVPPPVSVAPFVPAPPLSSAPPFQHPQQHHPQ 354

Query: 296 LFPTALRNISTNMSHGQTHNL-----TPILPFHVPEQHAHHPHSTNGY 424
L P + M G HN PI+P P H P N Y
Sbjct: 355 LPPPP---VHQGMGRGYHHNSPPQDPAPIVPVQAPPPQQHLPAPENVY 399


>sp|Q54EQ9|Y1586_DICDI Putative uncharacterized protein DDB_G0291608
OS=Dictyostelium discoideum GN=DDB_G0291608 PE=4 SV=1
Length = 919

Score = 33.9 bits (76), Expect = 0.36
Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 6/66 (9%)
Frame = +2

Query: 233 SLYTPFLPIPPKSKALPHAPNLFPTALRN----ISTNMSHGQTHNLTPILPF--HVPEQH 394
S + P P P+S +PH+P+L P + + S +M H +P +P H+P
Sbjct: 610 SPHPPHSPHMPQSPHMPHSPHLMPHSPHSPHMPHSPHMPHSPHMPHSPHMPHSPHMPHSP 669

Query: 395 AHHPHS 412
H PHS
Sbjct: 670 HHMPHS 675


>sp|Q14CM0|FRPD4_HUMAN FERM and PDZ domain-containing protein 4
OS=Homo sapiens GN=FRMPD4 PE=2 SV=1
Length = 1322

Score = 33.1 bits (74), Expect = 0.62
Identities = 18/60 (30%), Positives = 26/60 (43%)
Frame = +1

Query: 184 GHSQIALETVENPCQQKSLHPIPPHSSKVKSSTPRTKLVPYSTPQYQY*HVTWTNTQPDT 363
G+ +A E E P + +PP SS ++ P T L P P Q H +P+T
Sbjct: 942 GYHPLAEEQTEFPASKTPAGGLPPKSSHALAARPATDLPPKVVPSKQLLHSDHMEMEPET 1001


>sp|A6NL88|U626A_HUMAN UPF0626 protein A OS=Homo sapiens PE=2 SV=2
Length = 281

Score = 32.0 bits (71), Expect = 1.4
Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
Frame = +2

Query: 260 PPKSKALPHAPNLFPTALRNISTNMSHGQTHNLTPILPFHVPEQ-HAHHPHSTNGYDRPL 436
PP+S ALP P +L +N+ G TP+ P HAHH H+ +G +P
Sbjct: 174 PPRSPALPPDPTA-RASLAASHSNLLLGPGGPPTPLRGLPPPSSLHAHHHHALHGSPQPA 232

Query: 437 FLA 445
+++
Sbjct: 233 WMS 235


>sp|A7XYJ6|SOBPB_DANRE Sine oculis-binding protein homolog OS=Danio
rerio GN=sobpb PE=2 SV=1
Length = 668

Score = 32.0 bits (71), Expect = 1.4
Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 11/82 (13%)
Frame = +2

Query: 242 TPFLPIPPKSKALPHAPNLFPTALRNISTNMSHGQTHNLTPI--LPF---------HVPE 388
TP P PP P L +LR+ + N+ H H L+P +PF ++P
Sbjct: 342 TPEQPRPPHMPLPFIRPPLHAQSLRSPTPNLPHNPPHPLSPTQRVPFAPPPHYPLPYLPL 401

Query: 389 QHAHHPHSTNGYDRPLFLAPYP 454
P + +P+ + PYP
Sbjct: 402 HPTFPPQMPPPWPQPMMMMPYP 423


>sp|Q10669|MED23_CAEEL Mediator of RNA polymerase II transcription
subunit 23 OS=Caenorhabditis elegans GN=sur-2 PE=1 SV=1
Length = 1587

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/60 (33%), Positives = 26/60 (43%)
Frame = +3

Query: 216 ESMPAKVFTPHSSPFLQSQKLYPTHQTCSLQHSAISVLTCHMDKHTT*HQFYLSTFQNNT 395
ES P+ P LQ L P+HQ S L H+ HT+ HQ + T Q+ T
Sbjct: 1411 ESTPSVSSLPQMQHHLQQAPLLPSHQMMPPPQQHSSSLQHHLQHHTSTHQM-MDTSQHQT 1469


>sp|Q6NZ22|K1627_DANRE Methyltransferase-like protein KIAA1627
homolog OS=Danio rerio GN=zgc:77296 PE=2 SV=1
Length = 455

Score = 31.6 bits (70), Expect = 1.8
Identities = 19/70 (27%), Positives = 31/70 (44%)
Frame = -3

Query: 434 VVDRSHLWNEDDVRVVLERGKVKLVSGCVFVHVTC*Y*YCGVL*GTSLVRGVELLTLEEW 255
++ WN DD+ + L ++ + VF+ +CG G L R + L +W
Sbjct: 203 IIANERFWNWDDI-MKLNIEEISSIRSFVFL-------WCGSGEGLDLGR----MCLRKW 250

Query: 254 GGMGCKDFCW 225
G C+D CW
Sbjct: 251 GFRRCEDICW 260


>sp|Q8C3Q5|U626A_MOUSE UPF0626 protein A OS=Mus musculus PE=1 SV=2
Length = 298

Score = 31.6 bits (70), Expect = 1.8
Identities = 19/62 (30%), Positives = 30/62 (48%)
Frame = +2

Query: 260 PPKSKALPHAPNLFPTALRNISTNMSHGQTHNLTPILPFHVPEQHAHHPHSTNGYDRPLF 439
PP+S ALP P +L +N+ G TP+ HAHH H+ +G +P +
Sbjct: 192 PPRSPALPPDPTT-RASLAASHSNLLLGPGGPPTPLHGLPPSGLHAHHHHALHGSPQPAW 250

Query: 440 LA 445
++
Sbjct: 251 MS 252


>sp|Q569H4|PRR16_HUMAN Proline-rich protein 16 OS=Homo sapiens
GN=PRR16 PE=2 SV=1
Length = 304

Score = 31.2 bits (69), Expect = 2.3
Identities = 21/66 (31%), Positives = 28/66 (42%)
Frame = +2

Query: 218 IHASKSLYTPFLPIPPKSKALPHAPNLFPTALRNISTNMSHGQTHNLTPILPFHVPEQHA 397
+H P IP + LP P+L P L N +SH +++ PI P VP A
Sbjct: 231 VHLHSEPVHPPGKIPHQGPPLPPTPHLPPFPLENGGMGISH--SNSFPPIRPATVPPPTA 288

Query: 398 HHPHST 415
P T
Sbjct: 289 PKPQKT 294


>sp|Q63410|OTX1_RAT Homeobox protein OTX1 OS=Rattus norvegicus
GN=Otx1 PE=2 SV=1
Length = 355

Score = 31.2 bits (69), Expect = 2.3
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = +2

Query: 335 SHGQTHNLTPILPFHVPEQHAHHPHS 412
SH H L+P+ P + H HHPH+
Sbjct: 257 SHHHPHQLSPMAPSSMAGHHHHHPHA 282


tr_hit_id B3VTL6
Definition tr|B3VTL6|B3VTL6_MEDTR TIR-NBS-LRR RCT1 resistance protein OS=Medicago truncatula
Align length 46
Score (bit) 31.2
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921749|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G02.
(466 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3VTL6|B3VTL6_MEDTR TIR-NBS-LRR RCT1 resistance protein OS=Me... 31 0.021
tr|Q2XPG7|Q2XPG7_POPTR TIR-NBS disease resistance-like protein O... 30 0.095
tr|A7Q2M0|A7Q2M0_VITVI Chromosome chr1 scaffold_46, whole genome... 32 0.20
tr|A2I7Q5|A2I7Q5_9ROSI TIR-NBS-LRR class disease resistance prot... 29 0.21
tr|Q2MJQ3|Q2MJQ3_9ROSI TIR-NBS disease resistance-like protein O... 29 0.21
tr|Q2XPG6|Q2XPG6_POPTR TIR-NBS disease resistance-like protein O... 29 0.27
tr|Q2XPG9|Q2XPG9_POPTR TIR-NBS disease resistance-like protein O... 29 0.27
tr|Q710T8|Q710T8_POPDE TIR/NBS/LRR protein OS=Populus deltoides ... 34 0.44
tr|Q9FTA5|Q9FTA5_ARATH T7N9.24 OS=Arabidopsis thaliana PE=4 SV=1 33 0.56
tr|Q19PJ8|Q19PJ8_POPTR TIR-NBS type disease resistance protein O... 30 0.56
tr|Q1KT01|Q1KT01_POPTR TIR-NBS-LRR disease resistance-like prote... 29 0.57
tr|A7Q2L9|A7Q2L9_VITVI Chromosome chr1 scaffold_46, whole genome... 30 0.57
tr|Q5IFI7|Q5IFI7_AEDAE GATA transcription factor GATAc OS=Aedes ... 32 0.58
tr|Q16TJ3|Q16TJ3_AEDAE Transcription factor GATA-4 (GATA binding... 32 0.58
tr|Q1KT02|Q1KT02_POPBA TIR-NBS-LRR disease resistance-like prote... 29 0.73
tr|A7SH74|A7SH74_NEMVE Predicted protein (Fragment) OS=Nematoste... 36 1.1
tr|A7UUL3|A7UUL3_ANOGA AGAP008413-PA (Fragment) OS=Anopheles gam... 36 1.1
tr|Q8H0N7|Q8H0N7_POPTR TIR-NBS disease resistance protein OS=Pop... 35 1.4
tr|A7RT89|A7RT89_NEMVE Predicted protein OS=Nematostella vectens... 35 1.4
tr|A5AIN4|A5AIN4_VITVI Putative uncharacterized protein OS=Vitis... 32 1.5
tr|A2Q6C2|A2Q6C2_MEDTR TIR OS=Medicago truncatula GN=MtrDRAFT_AC... 29 1.6
tr|Q4RJF7|Q4RJF7_TETNG Chromosome 18 SCAF15038, whole genome sho... 35 2.5
tr|B6LZB7|B6LZB7_BRAFL Putative uncharacterized protein OS=Branc... 35 2.5
tr|Q2H1K3|Q2H1K3_CHAGB Putative uncharacterized protein OS=Chaet... 35 2.5
tr|B4PW08|B4PW08_DROYA GE14514 OS=Drosophila yakuba GN=GE14514 P... 34 3.2
tr|Q6ZP04|Q6ZP04_HUMAN CDNA FLJ26776 fis, clone PRS03665 OS=Homo... 34 3.2
tr|A7SH73|A7SH73_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 4.1
tr|Q55ZU3|Q55ZU3_CRYNE Putative uncharacterized protein OS=Crypt... 34 4.2
tr|Q9FTA6|Q9FTA6_ARATH T7N9.23 OS=Arabidopsis thaliana PE=4 SV=1 31 4.2
tr|Q3ZEA9|Q3ZEA9_CRYFE Apolipoprotein B (Fragment) OS=Cryptoproc... 33 5.4

>tr|B3VTL6|B3VTL6_MEDTR TIR-NBS-LRR RCT1 resistance protein
OS=Medicago truncatula GN=RCT1 PE=2 SV=1
Length = 1098

Score = 31.2 bits (69), Expect(2) = 0.021
Identities = 22/46 (47%), Positives = 24/46 (52%), Gaps = 9/46 (19%)
Frame = -3

Query: 464 DLLWDMGREIV--------VDRSHLWNEDDVRVVL-ERGKVKLVSG 354
DLL DMGREI+ +RS LW DDV VL E K V G
Sbjct: 516 DLLRDMGREIIREKSPMEPEERSRLWFHDDVLDVLSEHTGTKAVEG 561



Score = 30.4 bits (67), Expect(2) = 0.021
Identities = 15/40 (37%), Positives = 20/40 (50%)
Frame = -1

Query: 259 NGEEWGVKTFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
+ + + KTF M LR L LSG + GDF L+W
Sbjct: 570 SAQRFSTKTFENMKKLRLLQLSG-VQLDGDFKYISRNLKW 608


>tr|Q2XPG7|Q2XPG7_POPTR TIR-NBS disease resistance-like protein
OS=Populus trichocarpa PE=2 SV=1
Length = 1120

Score = 30.0 bits (66), Expect(2) = 0.095
Identities = 14/32 (43%), Positives = 19/32 (59%)
Frame = -1

Query: 235 TFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
+FA M L L ++G H+TG F L +EL W
Sbjct: 553 SFAKMKGLNLLQING-AHLTGSFKLLSKELMW 583



Score = 29.3 bits (64), Expect(2) = 0.095
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+ PS TL + VLD+ S + L
Sbjct: 590 PLKYFPSDFTLDNLAVLDMQYSNLKEL 616


>tr|A7Q2M0|A7Q2M0_VITVI Chromosome chr1 scaffold_46, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028940001
PE=4 SV=1
Length = 1418

Score = 31.6 bits (70), Expect(2) = 0.20
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = -1

Query: 238 KTFAGMDSLRFLVLSGNGHITGDFSLFPEELRWFQ 134
K+F M +LR L + N + G+F L P EL+W Q
Sbjct: 557 KSFESMINLRLLQID-NVQLEGEFKLMPAELKWLQ 590



Score = 26.6 bits (57), Expect(2) = 0.20
Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQ-ISRLSQAGHRF 31
PLK LPS + VLDLS+S+ I RL A +F
Sbjct: 595 PLKTLPSDFCPQGLRVLDLSESKNIERLMDASLQF 629


>tr|A2I7Q5|A2I7Q5_9ROSI TIR-NBS-LRR class disease resistance protein
OS=(Populus tomentosa x P. bolleana) x P. tomentosa PE=2
SV=1
Length = 678

Score = 29.3 bits (64), Expect(2) = 0.21
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = -1

Query: 238 KTFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
++FA M L L ++G H+TG F L +EL W
Sbjct: 589 RSFAKMKCLNLLQINGV-HLTGSFKLLSKELMW 620



Score = 28.9 bits (63), Expect(2) = 0.21
Identities = 13/27 (48%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+LPS L +VVLD S + L
Sbjct: 627 PLKYLPSDFILDNLVVLDTQYSNLKEL 653


>tr|Q2MJQ3|Q2MJQ3_9ROSI TIR-NBS disease resistance-like protein
OS=(Populus tomentosa x P. bolleana) x P. tomentosa var.
truncata PE=2 SV=1
Length = 642

Score = 29.3 bits (64), Expect(2) = 0.21
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = -1

Query: 238 KTFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
++FA M L L ++G H+TG F L +EL W
Sbjct: 553 RSFAKMKCLNLLQINGV-HLTGSFKLLSKELMW 584



Score = 28.9 bits (63), Expect(2) = 0.21
Identities = 13/27 (48%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+LPS L +VVLD S + L
Sbjct: 591 PLKYLPSDFILDNLVVLDTQYSNLKEL 617


>tr|Q2XPG6|Q2XPG6_POPTR TIR-NBS disease resistance-like protein
OS=Populus trichocarpa PE=2 SV=1
Length = 885

Score = 29.3 bits (64), Expect(2) = 0.27
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+ PS TL + VLD+ S + L
Sbjct: 531 PLKYFPSDFTLDNLAVLDMQYSNLKEL 557



Score = 28.5 bits (62), Expect(2) = 0.27
Identities = 14/32 (43%), Positives = 19/32 (59%)
Frame = -1

Query: 235 TFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
+FA M L L ++G H+TG F L +EL W
Sbjct: 494 SFAEMKCLNLLQINGV-HLTGSFKLLSKELMW 524


>tr|Q2XPG9|Q2XPG9_POPTR TIR-NBS disease resistance-like protein
OS=Populus trichocarpa PE=2 SV=1
Length = 735

Score = 29.3 bits (64), Expect(2) = 0.27
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+ PS TL + VLD+ S + L
Sbjct: 627 PLKYFPSDFTLDNLAVLDMQYSNLKEL 653



Score = 28.5 bits (62), Expect(2) = 0.27
Identities = 14/32 (43%), Positives = 19/32 (59%)
Frame = -1

Query: 235 TFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
+FA M L L ++G H+TG F L +EL W
Sbjct: 590 SFAEMKCLNLLQINGV-HLTGSFKLLSKELMW 620


>tr|Q710T8|Q710T8_POPDE TIR/NBS/LRR protein OS=Populus deltoides
GN=60I2G11 PE=4 SV=1
Length = 1147

Score = 28.5 bits (62), Expect(2) = 0.44
Identities = 14/32 (43%), Positives = 19/32 (59%)
Frame = -1

Query: 235 TFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
+FA M L L ++G H+TG LF +EL W
Sbjct: 578 SFAEMKCLNLLQINGV-HLTGSLKLFSKELMW 608



Score = 28.5 bits (62), Expect(2) = 0.44
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+LP TL + VLD+ S + L
Sbjct: 615 PLKYLPFDFTLDNLAVLDMQYSNLKEL 641



Score = 33.9 bits (76), Expect = 4.1
Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 8/41 (19%)
Frame = -3

Query: 464 DLLWDMGREIVVD--------RSHLWNEDDVRVVLERGKVK 366
DLL DMGRE+V R+ +WN++D VLE+ KV+
Sbjct: 514 DLLRDMGREVVCKASPKQPGKRTRIWNQEDAWNVLEQQKVR 554


>tr|Q9FTA5|Q9FTA5_ARATH T7N9.24 OS=Arabidopsis thaliana PE=4 SV=1
Length = 1590

Score = 33.1 bits (74), Expect(2) = 0.56
Identities = 16/36 (44%), Positives = 22/36 (61%)
Frame = -1

Query: 241 VKTFAGMDSLRFLVLSGNGHITGDFSLFPEELRWFQ 134
V++FA M LR L ++ N + GD L P EL+W Q
Sbjct: 802 VESFAPMKKLRLLQIN-NVELEGDLKLLPSELKWIQ 836



Score = 23.5 bits (49), Expect(2) = 0.56
Identities = 11/27 (40%), Positives = 18/27 (66%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PL+ LP + ++ VLDLS+S + R+
Sbjct: 841 PLENLPPDILSRQLGVLDLSESGVRRV 867


>tr|Q19PJ8|Q19PJ8_POPTR TIR-NBS type disease resistance protein
OS=Populus trichocarpa PE=2 SV=1
Length = 1421

Score = 30.4 bits (67), Expect(2) = 0.56
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = -1

Query: 238 KTFAGMDSLRFLVLSGNGHITGDFSLFPEELRW 140
++FA M L L ++G H+TG F L +EL W
Sbjct: 742 RSFAKMKRLNLLQING-AHLTGSFKLLSKELMW 773



Score = 26.2 bits (56), Expect(2) = 0.56
Identities = 11/27 (40%), Positives = 15/27 (55%)
Frame = -2

Query: 132 PLKFLPSQLTLSKVVVLDLSKSQISRL 52
PLK+ S TL + VLD+ S + L
Sbjct: 780 PLKYFSSDFTLDNLAVLDMQYSNLKEL 806