BP921754
Clone id YMU001_000153_G07
Library
Length 563
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCAAAAGACTCATCTTGGCTAGTTGCATAAGACACTGAAACTTTCATCTTTGTAGGTAG
GAAATGCTATCGAATACGACTAGAGTACATAAATGCTGCCACCGCTGACATCTTCTTATC
CAAAAGAAAAGACCGCTGAGGAAGCCAAAAGCTTGGAAGACAGACGAAGGGAGAATACTG
CCGATGGATGACTCCTCTGGTGCATGCTGAGGAAGCAAGCAGGTGCTTATATGAATATTA
GCAACATAGGTTAACTGGGTTTGATTCAAGCTTCAAACGCTCCATAGAGCCAAAGGAGCC
GAGCTAAAGCAGAGAGTTGAGAAGCTCTGCAACGCGTTTACCAGAAGAATGACATCCATA
GAATCTGGGGCAACGAAGTCAACCAAAAGTAATAGAGAGAAACAGTACCTGCAGGCTGCA
GGCCATACTCTCATACCGATTAGGAAGAGAGACGTTTAAAGGAAAGAGGCTCGGCGCCGC
TATTGATGGTAGGTGGATCTGCTCTGACATCGTGCTGGCTCTCGTGGGTTCTTGGAGGGT
CGCACCTGATTTTGTCGTATGAT
■■Homology search results ■■ -
sp_hit_id Q6DE55
Definition sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1 OS=Xenopus laevis
Align length 59
Score (bit) 33.5
E-value 0.74
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921754|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G07.
(563 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1 OS=X... 33 0.74
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=... 30 6.3
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosacchar... 30 8.2

>sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1
OS=Xenopus laevis GN=hmha1 PE=2 SV=1
Length = 1107

Score = 33.5 bits (75), Expect = 0.74
Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIE-SGATKSTKSNREKQYLQAAGHTLIPIR 444
++ ++R G +K RVEKLC AF +E S A+ SN K YL+ LIP R
Sbjct: 761 MKGIYRVNG--VKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFR 817


>sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens
GN=GMIP PE=1 SV=2
Length = 970

Score = 30.4 bits (67), Expect = 6.3
Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIE-SGATKSTKSNREKQYLQAAGHTLIPIRK 447
+Q ++R G+ + RVE+LC AF +E SG + S+ K++LQ +IP
Sbjct: 582 VQGIYRVSGSRV--RVERLCQAFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHL 639

Query: 448 RD 453
D
Sbjct: 640 YD 641


>sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c
OS=Schizosaccharomyces pombe GN=SPBC16A3.12c PE=2 SV=2
Length = 443

Score = 30.0 bits (66), Expect = 8.2
Identities = 34/124 (27%), Positives = 50/124 (40%), Gaps = 11/124 (8%)
Frame = -1

Query: 401 FSLLLLVDFVAPDSMDVILLVNALQSFSTLCFSSAPLALWSV*SLNQTQLTYVANIHIST 222
FSL + F PD++D IL + + + FS + S+N L NI I
Sbjct: 178 FSLDDMAMFDIPDTVDYILRETGREKLNYIGFSQGTAQAMAALSIN-PDLNDKVNIFIG- 235

Query: 221 CLLPQHAPEESS------IGSILPSSVFQAFGFLSGLFFWIRRC-----QRWQHLCTLVV 75
L P +AP+ S I + P ++ FG RRC WQ++C +
Sbjct: 236 -LAPAYAPKGFSNYFVDYIVKVNPKIMYHLFG---------RRCLLPSVTFWQNICYPPI 285

Query: 74 FDSI 63
F I
Sbjct: 286 FVKI 289


tr_hit_id A7K2S3
Definition tr|A7K2S3|A7K2S3_9VIBR MazG nucleotide pyrophosphohydrolase domain family OS=Vibrio sp. Ex25
Align length 49
Score (bit) 38.5
E-value 0.25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921754|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G07.
(563 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7K2S3|A7K2S3_9VIBR MazG nucleotide pyrophosphohydrolase doma... 39 0.25
tr|Q1V9Q2|Q1V9Q2_VIBAL MazG-related protein OS=Vibrio alginolyti... 37 0.74
tr|Q87I30|Q87I30_VIBPA MazG-related protein OS=Vibrio parahaemol... 36 1.7
tr|A6AYC7|A6AYC7_VIBPA MazG-related protein OS=Vibrio parahaemol... 36 1.7
tr|A3B3E7|A3B3E7_ORYSJ Putative uncharacterized protein OS=Oryza... 35 2.2
tr|B2VSP6|B2VSP6_PYRTR Putative uncharacterized protein OS=Pyren... 34 6.3
tr|B0JZA0|B0JZA0_XENTR Hmha1 protein OS=Xenopus tropicalis GN=hm... 33 8.2

>tr|A7K2S3|A7K2S3_9VIBR MazG nucleotide pyrophosphohydrolase domain
family OS=Vibrio sp. Ex25 GN=VEx25_A0596 PE=4 SV=1
Length = 129

Score = 38.5 bits (88), Expect = 0.25
Identities = 18/49 (36%), Positives = 31/49 (63%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIESGATKSTKSNREKQYLQA 417
L+ L R KG E ++ +E+ CN + +R+++IESG + ++KQ L A
Sbjct: 68 LKALEREKGIEPEKVLERACNKYDQRVSAIESGRSWDEVKQQQKQALNA 116


>tr|Q1V9Q2|Q1V9Q2_VIBAL MazG-related protein OS=Vibrio alginolyticus
12G01 GN=V12G01_09035 PE=4 SV=1
Length = 129

Score = 37.0 bits (84), Expect = 0.74
Identities = 17/49 (34%), Positives = 31/49 (63%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIESGATKSTKSNREKQYLQA 417
L+ L R KG + ++ +E+ CN + +R+++IESG + ++KQ L A
Sbjct: 68 LKALEREKGIDPEKVLERACNKYDQRVSAIESGRSWDEIKQQQKQALNA 116


>tr|Q87I30|Q87I30_VIBPA MazG-related protein OS=Vibrio
parahaemolyticus GN=VPA0776 PE=4 SV=1
Length = 129

Score = 35.8 bits (81), Expect = 1.7
Identities = 17/49 (34%), Positives = 30/49 (61%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIESGATKSTKSNREKQYLQA 417
L+TL R KG + ++ +E+ C + +R++ IESG + ++KQ L A
Sbjct: 68 LKTLEREKGIDPEKVLERACTKYEQRVSVIESGRSWDEVKQQQKQALNA 116


>tr|A6AYC7|A6AYC7_VIBPA MazG-related protein OS=Vibrio
parahaemolyticus AQ3810 GN=A79_1523 PE=4 SV=1
Length = 129

Score = 35.8 bits (81), Expect = 1.7
Identities = 17/49 (34%), Positives = 30/49 (61%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIESGATKSTKSNREKQYLQA 417
L+TL R KG + ++ +E+ C + +R++ IESG + ++KQ L A
Sbjct: 68 LKTLEREKGIDPEKVLERACTKYEQRVSVIESGRSWDEVKQQQKQALNA 116


>tr|A3B3E7|A3B3E7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017569 PE=4 SV=1
Length = 1644

Score = 35.4 bits (80), Expect = 2.2
Identities = 16/51 (31%), Positives = 34/51 (66%)
Frame = -1

Query: 395 LLLLVDFVAPDSMDVILLVNALQSFSTLCFSSAPLALWSV*SLNQTQLTYV 243
+L++ APD ILL++AL +++++ S P+A+W++ N+T+L ++
Sbjct: 1005 VLVMAWLSAPDKY-TILLMSALHNYTSVTLQSLPVAVWTIWPTNRTKLIWI 1054


>tr|B2VSP6|B2VSP6_PYRTR Putative uncharacterized protein
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_01802 PE=4 SV=1
Length = 369

Score = 33.9 bits (76), Expect = 6.3
Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
Frame = -1

Query: 248 YVANIHISTCL-LPQHAPEES-SIGSILPSSVFQAFGFLSGLFFW 120
Y AN IS + P+H PE+ I S F+AFG ++G+F W
Sbjct: 211 YTANAFISLGMQAPKHVPEDLFGITSFPVGDAFKAFGLIAGIFLW 255


>tr|B0JZA0|B0JZA0_XENTR Hmha1 protein OS=Xenopus tropicalis GN=hmha1
PE=2 SV=1
Length = 1004

Score = 33.5 bits (75), Expect = 8.2
Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
Frame = +1

Query: 271 LQTLHRAKGAELKQRVEKLCNAFTRRMTSIE-SGATKSTKSNREKQYLQAAGHTLIPIR 444
++ ++R G +K RVEKLC AF +E S A+ SN K YL+ LIP R
Sbjct: 657 MKGIYRVNG--VKTRVEKLCQAFENGKELVELSQASPHDLSNVLKLYLRQLPEPLIPFR 713