BP921759
Clone id YMU001_000153_G12
Library
Length 526
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_G12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACCGTCTACCAGCAGCCGTTGAGAATATCGAAAACCACCCCTTGTCACTAGACTCAGATG
CTGATGGCTGGCAGGTGGTCTCTTCAAAAAGCAAACGAAAGCTACGAAAATATTGAGTAC
TACGGGAGTTTGTAAATATTTGCAGCATGAGCTTCTTTCACGGTTTGATGTGAATATTTT
GAGCGTTTCTTTGGGAGTTCTTTTGCATTGGGACAGGAATTCTACAGAAATACGCGAAGA
ATTTGAGAAGTTTAGGTTTCCTAACATTCTATGGGACAATATCACACTGTGCACATCCTG
TAATTGCTATTTGCTTGTTCAGCCTATAATACCCTTTTGAAAGGCTGAAATTCTTAAAGA
GTGTACAATGAATTTGCCATAGCATTTTGTTGCTAACTTGAGTTCCCAAGCAGAGGTAAT
TTTACTTGTAATCTTGTCAGTGTGAGCTCAACTTCTTGAGAATGTTTTTTAAATATACAT
GGAGGCACACTGGCAATCTTCAACCTCCTTTCTGGAGTGCTGCTAT
■■Homology search results ■■ -
sp_hit_id Q96LT6
Definition sp|Q96LT6|CA074_HUMAN Uncharacterized protein C1orf74 OS=Homo sapiens
Align length 29
Score (bit) 31.6
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921759|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G12.
(526 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96LT6|CA074_HUMAN Uncharacterized protein C1orf74 OS=Homo sa... 32 2.4
sp|Q5REJ0|CA074_PONAB Uncharacterized protein C1orf74 homolog OS... 31 3.1
sp|Q6UVM4|KCNT2_RAT Potassium channel subfamily T member 2 OS=Ra... 30 7.1
sp|Q6UVM3|KCNT2_HUMAN Potassium channel subfamily T member 2 OS=... 30 7.1

>sp|Q96LT6|CA074_HUMAN Uncharacterized protein C1orf74 OS=Homo
sapiens GN=C1orf74 PE=2 SV=1
Length = 269

Score = 31.6 bits (70), Expect = 2.4
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +3

Query: 183 AFLWEFFCIGTGILQKYAKNLRSLGFLTF 269
A L++ C G LQ Y + L+ LGFLTF
Sbjct: 53 AVLYDCNCAGASELQSYLEELKGLGFLTF 81


>sp|Q5REJ0|CA074_PONAB Uncharacterized protein C1orf74 homolog
OS=Pongo abelii PE=2 SV=1
Length = 269

Score = 31.2 bits (69), Expect = 3.1
Identities = 14/29 (48%), Positives = 18/29 (62%)
Frame = +3

Query: 183 AFLWEFFCIGTGILQKYAKNLRSLGFLTF 269
A L++ C G LQ Y + L+ LGFLTF
Sbjct: 53 AVLYDCNCAGASELQSYLEELQGLGFLTF 81


>sp|Q6UVM4|KCNT2_RAT Potassium channel subfamily T member 2
OS=Rattus norvegicus GN=Kcnt2 PE=1 SV=1
Length = 1142

Score = 30.0 bits (66), Expect = 7.1
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = -2

Query: 267 MLGNLNFSNSSRISVEFLSQCKRTPKETLKIFTSNRERSS 148
+LG+ + N R+ VEF + T KE LK+F +RSS
Sbjct: 21 LLGDQGWQNDDRVQVEFYMN-ENTFKERLKLFFIKNQRSS 59


>sp|Q6UVM3|KCNT2_HUMAN Potassium channel subfamily T member 2
OS=Homo sapiens GN=KCNT2 PE=1 SV=1
Length = 1135

Score = 30.0 bits (66), Expect = 7.1
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = -2

Query: 267 MLGNLNFSNSSRISVEFLSQCKRTPKETLKIFTSNRERSS 148
+LG+ + N R+ VEF + T KE LK+F +RSS
Sbjct: 21 LLGDQGWQNDDRVQVEFYMN-ENTFKERLKLFFIKNQRSS 59


tr_hit_id B3RZH3
Definition tr|B3RZH3|B3RZH3_TRIAD Putative uncharacterized protein OS=Trichoplax adhaerens
Align length 69
Score (bit) 33.9
E-value 5.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921759|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_G12.
(526 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3RZH3|B3RZH3_TRIAD Putative uncharacterized protein OS=Trich... 34 5.1
tr|B8PGE2|B8PGE2_9APHY Predicted protein OS=Postia placenta Mad-... 33 6.7

>tr|B3RZH3|B3RZH3_TRIAD Putative uncharacterized protein
OS=Trichoplax adhaerens GN=TRIADDRAFT_57452 PE=4 SV=1
Length = 421

Score = 33.9 bits (76), Expect = 5.1
Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
Frame = +3

Query: 129 FVNICSMSFFHGLM*-IF*AFLWEFFCIGTGILQKYAKNLRSLGFLTFYGTISHCAHPVI 305
F ++ +S +HG + F WEF + +L+K A N+ F T YG + +HP++
Sbjct: 291 FGSLAFISLWHGFYAGYYLNFAWEFITV---LLEKQAGNV----FSTIYGAPFYQSHPLL 343

Query: 306 AICLFSL*Y 332
+ LF L Y
Sbjct: 344 KLALFPLAY 352


>tr|B8PGE2|B8PGE2_9APHY Predicted protein OS=Postia placenta
Mad-698-R GN=POSPLDRAFT_92637 PE=4 SV=1
Length = 359

Score = 33.5 bits (75), Expect = 6.7
Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
Frame = +2

Query: 113 LSTTGVCKYLQ-HELLSRFDVNILSVSLGVLLHWDRN 220
L T +C ++Q H S ++ N+ V +GVL WDRN
Sbjct: 262 LDPTMLCAHIQNHPTYSLYETNVFGVVVGVLCSWDRN 298