BP921770
Clone id YMU001_000153_H11
Library
Length 528
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000153_H11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTGAGAAAGAAAAGGAGATAATCAATAAGTATAAGAAAGACTTATTAGGAGACAAAGTT
GTTGAAAACATTACAAAACCAGTGGTTACATACAAATTATTAACTTGAACCACTCTTCAT
TTATAAAGAGATGTTGTCTTTGAGGCGTAGCTTTTGGGCAACCATCGTATTCTGGGTCCA
ATATCAGCTTTTTGCCTCCGCTTCAATGTAATTTGGCAGTGCACTTCGATGAAACAAAAC
ACATACAAAATTTCAATTTAACAAAAGAACCATGCTCATAACATACAATTCACAAAAACC
TACAAGTGATAACAACAATGTTTGTTCATAAAGACAACAAGAAGATAATCAACCACAAAT
GTCTGTCAACATGCCCCAAACAATATCAACATGCCCCGAACAAAAGAAATGAAAGCATGA
ATGTCTTGTGGGTAAGTCAAGGGTGTGAATCTCACAAATAATCAAAAGGGTTCCCACCCA
TAAGTTTGTCTTTCTCGTCCACTACATATGTGGATGTGGTTGCATCCT
■■Homology search results ■■ -
sp_hit_id Q3UPF5
Definition sp|Q3UPF5|ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 OS=Mus musculus
Align length 53
Score (bit) 29.6
E-value 9.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921770|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_H11.
(528 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3UPF5|ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 ... 30 9.2

>sp|Q3UPF5|ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1
OS=Mus musculus GN=Zc3hav1 PE=1 SV=1
Length = 946

Score = 29.6 bits (65), Expect = 9.2
Identities = 11/53 (20%), Positives = 26/53 (49%)
Frame = -3

Query: 253 KFCMCFVSSKCTAKLH*SGGKKLILDPEYDGCPKATPQRQHLFINEEWFKLII 95
++ +C++ + + ++ G K++ LD Y GC + + H + W I+
Sbjct: 581 EYSLCYIVNPVSPRMDDHGLKEICLDHLYRGCQQVNCNKNHFHLPYRWQLFIL 633


tr_hit_id B6L7S9
Definition tr|B6L7S9|B6L7S9_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 53
Score (bit) 33.5
E-value 6.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921770|Adiantum capillus-veneris mRNA, clone:
YMU001_000153_H11.
(528 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6L7S9|B6L7S9_BRAFL Putative uncharacterized protein OS=Branc... 33 6.7
tr|B7FWH3|B7FWH3_PHATR Predicted protein OS=Phaeodactylum tricor... 33 8.8
tr|Q7YXU7|Q7YXU7_DUGTI ORF2 (Fragment) OS=Dugesia tigrina PE=4 SV=1 33 8.8

>tr|B6L7S9|B6L7S9_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_67166 PE=4 SV=1
Length = 478

Score = 33.5 bits (75), Expect = 6.7
Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 6/53 (11%)
Frame = -2

Query: 173 RIRWLPKSYASKTTSLYK*RVVQVNNLYVTTGFVMF------STTLSPNKSFL 33
R RW+P + A++ L + V+ NN Y++ GF+++ ST +SP+ L
Sbjct: 416 RRRWIPSTLANQILLLKNWKDVKKNNKYISMGFLLYQVILLLSTVISPSTCIL 468


>tr|B7FWH3|B7FWH3_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_11690 PE=4 SV=1
Length = 251

Score = 33.1 bits (74), Expect = 8.8
Identities = 26/95 (27%), Positives = 40/95 (42%)
Frame = +3

Query: 237 KHIQNFNLTKEPCS*HTIHKNLQVITTMFVHKDNKKIINHKCLSTCPKQYQHAPNKRNES 416
K ++ F L E + H ++ + V D II + PK Y HA + +
Sbjct: 101 KQVEVFRLQMELAAKHQRPVSIHTVQCFGVLMDTLSIIKKSTVKLPPKMYFHAFGGKQGT 160

Query: 417 MNVLWVSQGCESHK*SKGFPPISLSFSSTTYVDVV 521
++ L G E K GF P+ ++F S DVV
Sbjct: 161 IDQLLALCGREPGKVYFGFAPV-INFRSPKTADVV 194


>tr|Q7YXU7|Q7YXU7_DUGTI ORF2 (Fragment) OS=Dugesia tigrina PE=4 SV=1
Length = 1171

Score = 33.1 bits (74), Expect = 8.8
Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
Frame = +3

Query: 165 SYSGSNISFLP-PLQCNLAVHFDETKHIQNFNLTKEPCS*HTIHKNLQVITTMFVHKDNK 341
SY+ N SFL P N+ H D H+Q N+ ++ + H I + + + T H ++
Sbjct: 118 SYNNYNHSFLASPYTTNITEHADINMHVQEVNMQQDNNTQHAITQQVSLQATSLQHTLDE 177

Query: 342 KIINHKCLSTCPKQYQHA 395
I+ K+++ A
Sbjct: 178 MIVQFNTAVRLKKKHKVA 195