BP921771
Clone id YMU001_000154_A01
Library
Length 520
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000154_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTACAAACACAACTGCTATGAATTCTCATTGACTACAAGAGTAATTT
CTTTGCAATTTACAAACATATATTGTCAAAGACTCGATACACAATTGCTAGGACTGCCCT
GAACTACAAGAGCAATTTACATGGGATTCTACTAACCCTCCTCAACTGTAAATTCTGAAT
ATTGAAGTCTAACAATTTCCTCCAACAACAAAATGAAAGATTTTCCATATGGACAAGGAA
CTTATTGATTATGCCGTTAGATACCAGTAAAACCTCCCTTATGGAATGATTCTCTTGCGC
CTCATCTTGTCAACCCAATGTAGTATTGATGTTTCTGTATTGCGGAATCCCAAAAATCCC
AATTCCTTGGCTTTGTTTGGATTGAGATTCGCGGGTACAGGTGTATTTAGTGTAAAGTCG
ACAAACCACCAATTGCCAACGTCATCCAATTTGGTTGGTACCAAATCATGCTCTTCCACC
ATCACATCCCAAACAGGGCCCTTATCCTTCATCAACTCGA
■■Homology search results ■■ -
sp_hit_id Q555D2
Definition sp|Q555D2|Y6503_DICDI Uncharacterized protein DDB_G0274915 OS=Dictyostelium discoideum
Align length 70
Score (bit) 30.8
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921771|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_A01.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q555D2|Y6503_DICDI Uncharacterized protein DDB_G0274915 OS=Di... 31 3.8
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member ... 30 4.9
sp|Q7UZN3|SAHH_PROMP Adenosylhomocysteinase OS=Prochlorococcus m... 30 6.5

>sp|Q555D2|Y6503_DICDI Uncharacterized protein DDB_G0274915
OS=Dictyostelium discoideum GN=DDB_G0274915 PE=4 SV=2
Length = 1839

Score = 30.8 bits (68), Expect = 3.8
Identities = 21/70 (30%), Positives = 29/70 (41%)
Frame = +1

Query: 295 STQCSIDVSVLRNPKNPNSLALFGLRFAGTGVFSVKSTNHQLPTSSNLVGTKSCSSTITS 474
S+ SI S + S LFG TG+F +T S+ L G+ S+T T+
Sbjct: 1321 SSSSSISSSSTTSTTTTPSTGLFGSTTPSTGLFGSTTTAATTTPSTGLFGSTPSSTTSTT 1380

Query: 475 QTGPLSFINS 504
T P S
Sbjct: 1381 TTPPNGLFGS 1390


>sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4
OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1
Length = 260

Score = 30.4 bits (67), Expect = 4.9
Identities = 13/43 (30%), Positives = 25/43 (58%)
Frame = -2

Query: 255 LLVSNGIINKFLVHMENLSFCCWRKLLDFNIQNLQLRRVSRIP 127
+LVSN +N F + +++ W K+LD N++ + L + +P
Sbjct: 94 ILVSNAAVNPFFGKLMDVTEEVWDKILDINVKAMALMTKAVVP 136


>sp|Q7UZN3|SAHH_PROMP Adenosylhomocysteinase OS=Prochlorococcus
marinus subsp. pastoris (strain CCMP1378 / MED4) GN=ahcY
PE=3 SV=1
Length = 472

Score = 30.0 bits (66), Expect = 6.5
Identities = 13/26 (50%), Positives = 18/26 (69%)
Frame = +1

Query: 286 LILSTQCSIDVSVLRNPKNPNSLALF 363
LIL ++ D+SVL+NP N +ALF
Sbjct: 146 LILGSKAEKDLSVLKNPSNEEEIALF 171


tr_hit_id A9NUD2
Definition tr|A9NUD2|A9NUD2_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 79
Score (bit) 111.0
E-value 2.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921771|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_A01.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUD2|A9NUD2_PICSI Putative uncharacterized protein OS=Picea... 111 2e-23
tr|B8LM29|B8LM29_PICSI Putative uncharacterized protein OS=Picea... 110 4e-23
tr|A9NUS7|A9NUS7_PICSI Putative uncharacterized protein OS=Picea... 108 1e-22
tr|B8LLZ6|B8LLZ6_PICSI Putative uncharacterized protein OS=Picea... 108 2e-22
tr|A7NU62|A7NU62_VITVI Chromosome chr18 scaffold_1, whole genome... 96 1e-18
tr|A5B9D4|A5B9D4_VITVI Putative uncharacterized protein OS=Vitis... 96 1e-18
tr|A7QW81|A7QW81_VITVI Chromosome chr3 scaffold_199, whole genom... 96 1e-18
tr|A9PJM6|A9PJM6_POPJC Putative uncharacterized protein OS=Popul... 92 1e-17
tr|Q2HRK0|Q2HRK0_MEDTR VEP1 , putative OS=Medicago truncatula GN... 89 9e-17
tr|Q2HRJ8|Q2HRJ8_MEDTR Progesterone 5-beta-reductase, putative O... 87 4e-16
tr|A9PFK7|A9PFK7_POPTR Putative uncharacterized protein OS=Popul... 87 6e-16
tr|A9PFI1|A9PFI1_POPTR Putative uncharacterized protein OS=Popul... 87 6e-16
tr|A9PK77|A9PK77_POPJC Putative uncharacterized protein OS=Popul... 85 2e-15
tr|A9PHE6|A9PHE6_POPTR Putative uncharacterized protein OS=Popul... 85 2e-15
tr|Q3HLM6|Q3HLM6_9LAMI Progesterone 5-beta-reductase OS=Digitali... 84 4e-15
tr|Q2HRK1|Q2HRK1_MEDTR Putative uncharacterized protein OS=Medic... 84 4e-15
tr|Q078S3|Q078S3_9LAMI Progesterone 5beta-reductase OS=Isoplexis... 84 5e-15
tr|Q00P19|Q00P19_9LAMI Progesterone 5-beta-reductase OS=Digitali... 84 5e-15
tr|Q6PQK0|Q6PQK0_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q6PQJ9|Q6PQJ9_DIGLA Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q3HLN0|Q3HLN0_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q3HLM7|Q3HLM7_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q078S5|Q078S5_9LAMI Progesterone 5beta-reductase OS=Isoplexis... 82 1e-14
tr|Q6PQK1|Q6PQK1_DIGGR Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q5XTQ7|Q5XTQ7_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q5XLZ9|Q5XLZ9_9LAMI Progesterone 5 beta reductase OS=Digitali... 82 1e-14
tr|Q3HLN1|Q3HLN1_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q3HLM9|Q3HLM9_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q3HLM8|Q3HLM8_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14
tr|Q2XSK7|Q2XSK7_9LAMI Progesterone 5-beta-reductase OS=Digitali... 82 1e-14

>tr|A9NUD2|A9NUD2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 399

Score = 111 bits (278), Expect = 2e-23
Identities = 47/79 (59%), Positives = 59/79 (74%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E MKDKGPVWD +V E+ L PTK+++VGNWWF DFTLN P + NK+KE GF GFRN
Sbjct: 321 EAMKDKGPVWDALVRENKLHPTKIEEVGNWWFADFTLNLPQETVHSMNKSKEYGFFGFRN 380

Query: 323 TETSILHWVDKMRRKRIIP 267
TETS+ W+DKM+ ++P
Sbjct: 381 TETSLGQWIDKMKASNVVP 399


>tr|B8LM29|B8LM29_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 399

Score = 110 bits (275), Expect = 4e-23
Identities = 47/79 (59%), Positives = 58/79 (73%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E MKDKGPVWD +V E+ L PTK+++VGNWWF DF LN P + NK+KE GF GFRN
Sbjct: 321 EAMKDKGPVWDAIVGENKLYPTKIEEVGNWWFADFVLNVPWEPVFSMNKSKEYGFFGFRN 380

Query: 323 TETSILHWVDKMRRKRIIP 267
TETS+ W+DK+R I+P
Sbjct: 381 TETSVGQWIDKIRASNIVP 399


>tr|A9NUS7|A9NUS7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 399

Score = 108 bits (270), Expect = 1e-22
Identities = 47/79 (59%), Positives = 59/79 (74%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E+MKDKGPVWD +V E+ L PTK+++VGNWWF D LN P L+ NK+KE GF GFRN
Sbjct: 321 EVMKDKGPVWDAIVGENKLHPTKIEEVGNWWFADLVLNPPWGTVLSMNKSKEYGFFGFRN 380

Query: 323 TETSILHWVDKMRRKRIIP 267
TETS+ W+DK+R I+P
Sbjct: 381 TETSMGQWIDKVRSSNIVP 399


>tr|B8LLZ6|B8LLZ6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 399

Score = 108 bits (269), Expect = 2e-22
Identities = 46/79 (58%), Positives = 58/79 (73%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E MKDKGPVWD +V E+ L PTK+++VGNWWF +FTLN P + NK+KE GF GFRN
Sbjct: 321 EAMKDKGPVWDALVRENKLHPTKIEEVGNWWFAEFTLNLPQEMINSMNKSKEYGFFGFRN 380

Query: 323 TETSILHWVDKMRRKRIIP 267
TETS+ W+DKM+ +P
Sbjct: 381 TETSLGQWIDKMKASNAVP 399


>tr|A7NU62|A7NU62_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014929001
PE=4 SV=1
Length = 269

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/79 (54%), Positives = 56/79 (70%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E+MKDKGPVW+ +V E +L+PTKL+DV WWF+D L N NK+KE GFLGFRN
Sbjct: 192 EMMKDKGPVWEEIVREKELLPTKLEDVAQWWFIDLVLGGESLLNC-MNKSKEHGFLGFRN 250

Query: 323 TETSILHWVDKMRRKRIIP 267
+ S + W+DKMR ++IP
Sbjct: 251 SRNSFVWWIDKMRGHKLIP 269


>tr|A5B9D4|A5B9D4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028488 PE=4 SV=1
Length = 1000

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/79 (54%), Positives = 56/79 (70%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E+MKDKGPVW+ +V E +L+PTKL+DV WWF+D L N NK+KE GFLGFRN
Sbjct: 923 EMMKDKGPVWEEIVREKELLPTKLEDVAQWWFIDLVLGGESLLNC-MNKSKEHGFLGFRN 981

Query: 323 TETSILHWVDKMRRKRIIP 267
+ S + W+DKMR ++IP
Sbjct: 982 SRNSFVWWIDKMRGHKLIP 1000


>tr|A7QW81|A7QW81_VITVI Chromosome chr3 scaffold_199, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007733001
PE=4 SV=1
Length = 280

Score = 95.5 bits (236), Expect = 1e-18
Identities = 42/79 (53%), Positives = 58/79 (73%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
++MKDKGPVWD +V E LVPTKL++VG WWF D L+ + + NK+KE GFLGFRN
Sbjct: 203 KMMKDKGPVWDEIVREKGLVPTKLEEVGQWWFADVVLSAGSSLD-SMNKSKEHGFLGFRN 261

Query: 323 TETSILHWVDKMRRKRIIP 267
+++S L W+DKM+ + +P
Sbjct: 262 SKSSFLSWIDKMKAYKFVP 280


>tr|A9PJM6|A9PJM6_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 388

Score = 92.0 bits (227), Expect = 1e-17
Identities = 41/79 (51%), Positives = 58/79 (73%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
E MKDKGPVW+ +V+++ L PTKL++VG WW+VD L+ + NK+KE GFLGFRN
Sbjct: 310 ERMKDKGPVWEEIVKKNQLFPTKLEEVGGWWYVDTMLSGDAFISC-MNKSKEHGFLGFRN 368

Query: 323 TETSILHWVDKMRRKRIIP 267
+ S +HW+ KMR +++IP
Sbjct: 369 STKSFVHWIGKMRSQKVIP 387


>tr|Q2HRK0|Q2HRK0_MEDTR VEP1 , putative OS=Medicago truncatula
GN=MtrDRAFT_AC158501g32v2 PE=4 SV=2
Length = 407

Score = 89.4 bits (220), Expect = 9e-17
Identities = 39/79 (49%), Positives = 59/79 (74%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
+LMKDKG VW+ +V E++L+ TKL++VG+WWF DF+L + + NKAKE GF+GFRN
Sbjct: 330 DLMKDKGGVWEEIVRENELLYTKLEEVGDWWFADFSLRLEGVLD-SMNKAKEHGFIGFRN 388

Query: 323 TETSILHWVDKMRRKRIIP 267
++ S + W+DK + +I+P
Sbjct: 389 SKNSFISWIDKTKAYKIVP 407


>tr|Q2HRJ8|Q2HRJ8_MEDTR Progesterone 5-beta-reductase, putative
OS=Medicago truncatula GN=MtrDRAFT_AC158501g29v2 PE=4
SV=2
Length = 387

Score = 87.0 bits (214), Expect = 4e-16
Identities = 38/79 (48%), Positives = 57/79 (72%)
Frame = -3

Query: 503 ELMKDKGPVWDVMVEEHDLVPTKLDDVGNWWFVDFTLNTPVPANLNPNKAKELGFLGFRN 324
+LMKDKG VW+ +V E++L+ TKL++VG+WWF DF + + NK+KE GFLGFRN
Sbjct: 310 DLMKDKGGVWEEIVRENELLYTKLEEVGDWWFADFMFRVEGVLD-SMNKSKEHGFLGFRN 368

Query: 323 TETSILHWVDKMRRKRIIP 267
++ S + W+DK + +I+P
Sbjct: 369 SKNSFISWIDKTKAYKIVP 387