BP921784
Clone id YMU001_000154_B04
Library
Length 538
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000154_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGGCTCTGTCGTACATAATGCGAGGGGGTATGGCTATGCTCCGACTGCTGGCCTTTTCC
AGTCTAGTGGTTGGGGGAAGAGCAGGGTGGTATGCGAATTGTGGAAGAAGGATGTATGGG
TTGTTTATTGTTCGTTTGCAGCTGGGACTGGCTATCCCAAGATATCTCCGATAGCGAAAT
GGTTCCATCAGCAAGCTATGAAGCATCTTGGCAGTGATGAGAGCCTACGAGGGCAACTAG
CTTGCATGAATTTTACTTTGGCTTACTTCTGTGCATGCTTGTGTGTGCTGGAAAATAAAG
TGAAGAATAGTGATTGGAATCGTGAAAAGTTTTTGATCGAGACAAGACAAGGCAACAATT
ATTGGGAGGATGTGCAAGAGCAGACCGAGAAATTTCTAGCTGTGCTCAGTCGAAAAGATG
GTTTGACTAAAATTCAGCAAAGCAAGCAGATTACATGGGCCACGTGGGAAACCGAAGCTC
ATACAGAATTTGTGAGATTTTGGCCAAACAGTTTGATGAAGAATGCTCAGAAGCTGGA
■■Homology search results ■■ -
sp_hit_id Q08964
Definition sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae
Align length 60
Score (bit) 34.3
E-value 0.39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921784|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_B04.
(538 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex... 34 0.39
sp|P29258|STP2_PIG Nuclear transition protein 2 OS=Sus scrofa GN... 33 0.68
sp|Q03073|FIXN_BRAJA Cytochrome c oxidase subunit 1 homolog, bac... 32 1.9
sp|Q9VBQ9|MED28_DROME Mediator of RNA polymerase II transcriptio... 31 4.3
sp|P98056|FIXN_AZOC5 Cytochrome c oxidase subunit 1 homolog OS=A... 31 4.3
sp|O19084|CDSN_PIG Corneodesmosin (Fragment) OS=Sus scrofa GN=CD... 30 5.7
sp|Q294G7|MED28_DROPS Mediator of RNA polymerase II transcriptio... 30 9.7
sp|Q2JJ73|HRCA_SYNJB Heat-inducible transcription repressor hrcA... 30 9.7

>sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex
subunit YPL216W OS=Saccharomyces cerevisiae GN=YPL216W
PE=1 SV=1
Length = 1102

Score = 34.3 bits (77), Expect = 0.39
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = +3

Query: 195 AMKHLGSDESLRGQLACMNFTLAYFCACLCVLENKVKNSDWNREKFLIETRQGNN-YWED 371
+M GSDE +G++ + +AY + LE K+ SD R + L + R GN YW D
Sbjct: 709 SMNRYGSDEC-KGKVNALKVKIAYLMEDIAFLEAKLIQSDIKRLEILGKDRNGNRYYWMD 767


>sp|P29258|STP2_PIG Nuclear transition protein 2 OS=Sus scrofa
GN=TNP2 PE=2 SV=1
Length = 137

Score = 33.5 bits (75), Expect = 0.68
Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
Frame = -2

Query: 288 AHTSMH-RSKPK*NSCKLVALVGSHHCQDAS*LADGTISLSEISWDSQSQLQTNNKQPIH 112
AHT H S P+ ++C + SHHCQ+ S D + S S SQS + P H
Sbjct: 11 AHTQPHSNSGPQSHACNQCSC--SHHCQNCSQSCDRSQSCSRSRSSSQSP-TGHRSLPGH 67

Query: 111 PSSTIRIPPCSSPNH*TGKGQQSEHSH 31
S + + P SP H +++ HSH
Sbjct: 68 QSQS--LSPSPSPRH----RKRAMHSH 88


>sp|Q03073|FIXN_BRAJA Cytochrome c oxidase subunit 1 homolog,
bacteroid OS=Bradyrhizobium japonicum GN=fixN PE=2 SV=1
Length = 549

Score = 32.0 bits (71), Expect = 1.9
Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 8/75 (10%)
Frame = +3

Query: 27 GYGYAPTAGLFQSSGWGKSRVVCELWKKDVWVVYCSFAAGTGYPKISP---IAKWFHQQ- 194
G GY G+ QS + + +LW VWVVY T + P +A WF+
Sbjct: 181 GTGYL--LGVTQSKEYAEPEWYADLWLTIVWVVYLLVFLATIIKRKEPHIFVANWFYLAF 238

Query: 195 ----AMKHLGSDESL 227
A+ HLG++ +L
Sbjct: 239 IVTIAVLHLGNNPAL 253


>sp|Q9VBQ9|MED28_DROME Mediator of RNA polymerase II transcription
subunit 28 OS=Drosophila melanogaster GN=MED28 PE=1 SV=1
Length = 189

Score = 30.8 bits (68), Expect = 4.3
Identities = 21/63 (33%), Positives = 32/63 (50%)
Frame = +3

Query: 207 LGSDESLRGQLACMNFTLAYFCACLCVLENKVKNSDWNREKFLIETRQGNNYWEDVQEQT 386
+ S+ES G L M+ F +CL L + NS N+E+ +E ++ N + DV Q
Sbjct: 1 MASNESGGGNL--MDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQM 58

Query: 387 EKF 395
E F
Sbjct: 59 EAF 61


>sp|P98056|FIXN_AZOC5 Cytochrome c oxidase subunit 1 homolog
OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM
5975 / ORS 571) GN=fixN PE=3 SV=1
Length = 551

Score = 30.8 bits (68), Expect = 4.3
Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 8/75 (10%)
Frame = +3

Query: 27 GYGYAPTAGLFQSSGWGKSRVVCELWKKDVWVVYCSFAAGTGYPKISP---IAKWFHQQ- 194
G GY G+ Q + + +LW VWV Y GT + P +A WF+
Sbjct: 182 GTGYL--LGITQGKEYAEPEWYADLWLTIVWVTYFLVFLGTVLKRKEPHIYVANWFYLAF 239

Query: 195 ----AMKHLGSDESL 227
A+ HLG++ ++
Sbjct: 240 ILTIAVLHLGNNAAI 254


>sp|O19084|CDSN_PIG Corneodesmosin (Fragment) OS=Sus scrofa GN=CDSN
PE=3 SV=1
Length = 225

Score = 30.4 bits (67), Expect = 5.7
Identities = 19/64 (29%), Positives = 26/64 (40%)
Frame = -2

Query: 225 GSHHCQDAS*LADGTISLSEISWDSQSQLQTNNKQPIHPSSTIRIPPCSSPNH*TGKGQQ 46
G C S + G SLS S S + +++ HP T+ PCS P + G
Sbjct: 105 GVQPCGVGSSGSKGPCSLSGSGVHSSSSISSSSGSSFHPCGTVSQGPCSPPGTGSFSGSS 164

Query: 45 SEHS 34
S S
Sbjct: 165 SSKS 168


>sp|Q294G7|MED28_DROPS Mediator of RNA polymerase II transcription
subunit 28 OS=Drosophila pseudoobscura pseudoobscura
GN=MED28 PE=3 SV=1
Length = 190

Score = 29.6 bits (65), Expect = 9.7
Identities = 15/43 (34%), Positives = 23/43 (53%)
Frame = +3

Query: 267 FCACLCVLENKVKNSDWNREKFLIETRQGNNYWEDVQEQTEKF 395
F +CL L + NS N+E+ +E ++ N + DV Q E F
Sbjct: 19 FQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAF 61


>sp|Q2JJ73|HRCA_SYNJB Heat-inducible transcription repressor hrcA
OS=Synechococcus sp. GN=hrcA PE=3 SV=1
Length = 389

Score = 29.6 bits (65), Expect = 9.7
Identities = 13/31 (41%), Positives = 19/31 (61%)
Frame = -3

Query: 104 PQFAYHPALPPTTRLEKASSRSIAIPPRIMY 12
PQ AY P LP +T +++ S +S P I+Y
Sbjct: 300 PQLAYLPPLPSSTEMDQESGQSARKTPVIIY 330


tr_hit_id B8P9W0
Definition tr|B8P9W0|B8P9W0_9APHY Predicted protein OS=Postia placenta Mad-698-R
Align length 51
Score (bit) 35.0
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921784|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_B04.
(538 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8P9W0|B8P9W0_9APHY Predicted protein OS=Postia placenta Mad-... 35 2.5
tr|B5VSW5|B5VSW5_YEAS6 YPL216Wp-like protein OS=Saccharomyces ce... 34 4.2
tr|B3LKL4|B3LKL4_YEAS1 Putative uncharacterized protein OS=Sacch... 34 4.2
tr|A6ZW39|A6ZW39_YEAS7 Conserved protein OS=Saccharomyces cerevi... 34 4.2
tr|A8P9F0|A8P9F0_COPC7 Putative uncharacterized protein OS=Copri... 34 5.5
tr|A2WJA9|A2WJA9_9BURK Mn2+ and Fe2+ transporter OS=Burkholderia... 34 5.6
tr|B0CV30|B0CV30_LACBS Predicted protein OS=Laccaria bicolor (st... 33 7.3
tr|Q8HMI7|Q8HMI7_9TELE NADH dehydrogenase subunit 4L OS=Carapus ... 33 9.3
tr|Q4KPB4|Q4KPB4_9CONI NEEDLY-like protein (Fragment) OS=Podocar... 33 9.5

>tr|B8P9W0|B8P9W0_9APHY Predicted protein OS=Postia placenta
Mad-698-R GN=POSPLDRAFT_104209 PE=4 SV=1
Length = 500

Score = 35.0 bits (79), Expect = 2.5
Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
Frame = +3

Query: 12 VHNARGYG-YAPTAGLFQSSGWGKSRVVCELWKKDVWVVYCSF-AAGTGYP 158
++++RG YA + L QSSG GKSR V EL KD++V+ + TGYP
Sbjct: 238 INSSRGMNPYANSMPLLQSSGMGKSRTVDEL-AKDIFVIPLNVRREATGYP 287


>tr|B5VSW5|B5VSW5_YEAS6 YPL216Wp-like protein OS=Saccharomyces
cerevisiae (strain AWRI1631) GN=AWRI1631_160550 PE=4
SV=1
Length = 932

Score = 34.3 bits (77), Expect = 4.2
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = +3

Query: 195 AMKHLGSDESLRGQLACMNFTLAYFCACLCVLENKVKNSDWNREKFLIETRQGNN-YWED 371
+M GSDE +G++ + +AY + LE K+ SD R + L + R GN YW D
Sbjct: 539 SMNRYGSDEC-KGKVNALKVKIAYLMEDIAFLEAKLIQSDIKRLEILGKDRNGNRYYWMD 597


>tr|B3LKL4|B3LKL4_YEAS1 Putative uncharacterized protein
OS=Saccharomyces cerevisiae (strain RM11-1a)
GN=SCRG_02283 PE=4 SV=1
Length = 1099

Score = 34.3 bits (77), Expect = 4.2
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = +3

Query: 195 AMKHLGSDESLRGQLACMNFTLAYFCACLCVLENKVKNSDWNREKFLIETRQGNN-YWED 371
+M GSDE +G++ + +AY + LE K+ SD R + L + R GN YW D
Sbjct: 706 SMNRYGSDEC-KGKVNALKVKIAYLMEDIAFLEAKLIQSDIKRLEILGKDRNGNRYYWMD 764


>tr|A6ZW39|A6ZW39_YEAS7 Conserved protein OS=Saccharomyces
cerevisiae (strain YJM789) GN=SCY_5516 PE=4 SV=1
Length = 1099

Score = 34.3 bits (77), Expect = 4.2
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = +3

Query: 195 AMKHLGSDESLRGQLACMNFTLAYFCACLCVLENKVKNSDWNREKFLIETRQGNN-YWED 371
+M GSDE +G++ + +AY + LE K+ SD R + L + R GN YW D
Sbjct: 706 SMNRYGSDEC-KGKVNALKVKIAYLMEDIAFLEAKLIQSDIKRLEILGKDRNGNRYYWMD 764


>tr|A8P9F0|A8P9F0_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_09661 PE=4 SV=1
Length = 530

Score = 33.9 bits (76), Expect = 5.5
Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 6/111 (5%)
Frame = +3

Query: 78 KSRVVCELWKKDVWVVYCSFAAGTGYPKISPIAKWFHQQAMKHLGSDESLRGQLACMNFT 257
K + V E W +D + F AG GY + + F ++H S L G ++C+
Sbjct: 279 KLQAVLEKWARDGFPKKEIFHAGKGYHRSAANPPPFFAYILQHTYSQRDLAGGMSCLKGQ 338

Query: 258 LAYFCACLCVLENKV------KNSDWNREKFLIETRQGNNYWEDVQEQTEK 392
A+ A L L N++ N D + + YW ++++ E+
Sbjct: 339 DAHKIALLLSLANELGFKLAFANLDIKVRGLADDYERYQVYWGKIRQEKER 389


>tr|A2WJA9|A2WJA9_9BURK Mn2+ and Fe2+ transporter OS=Burkholderia
dolosa AUO158 GN=BDAG_04913 PE=4 SV=1
Length = 490

Score = 33.9 bits (76), Expect = 5.6
Identities = 20/56 (35%), Positives = 32/56 (57%)
Frame = +1

Query: 4 ALSYIMRGGMAMLRLLAFSSLVVGGRAGWYANCGRRMYGLFIVRLQLGLAIPRYLR 171
AL ++ G + + ++LVVGGR+ WYA +YG+ + LQ+ L+ RY R
Sbjct: 162 ALVNVVNVGADLAAMGDATALVVGGRSYWYA----PVYGIVSLALQMTLSYERYSR 213


>tr|B0CV30|B0CV30_LACBS Predicted protein OS=Laccaria bicolor
(strain S238N-H82) GN=LACBIDRAFT_292492 PE=4 SV=1
Length = 908

Score = 33.5 bits (75), Expect = 7.3
Identities = 19/71 (26%), Positives = 29/71 (40%), Gaps = 14/71 (19%)
Frame = -2

Query: 189 DGTISLSEISWDSQSQLQTNNKQPIHPSSTIRIPPCSSPNH*TGKG-------------- 52
DG S ++ D+++ Q+NN P H + R+PP + P +
Sbjct: 364 DGVASSPPLAADTKAHTQSNNLLPSHGEPSSRLPPSTIPKTPSANSISPSITDTQNEPFT 423

Query: 51 QQSEHSHTPSH 19
S H H PSH
Sbjct: 424 SASNHDHQPSH 434


>tr|Q8HMI7|Q8HMI7_9TELE NADH dehydrogenase subunit 4L OS=Carapus
bermudensis GN=ND4L PE=4 SV=1
Length = 98

Score = 33.1 bits (74), Expect = 9.3
Identities = 15/38 (39%), Positives = 24/38 (63%)
Frame = -3

Query: 389 LGLLLHILPIIVALSCLDQKLFTIPITILHFIFQHTQA 276
LGL LH + +I AL CL+ + T+ +T+ + +HT A
Sbjct: 17 LGLALHRVHLISALLCLEAMMLTLYVTLSVWALEHTSA 54


>tr|Q4KPB4|Q4KPB4_9CONI NEEDLY-like protein (Fragment) OS=Podocarpus
matudae var. reichei PE=2 SV=1
Length = 295

Score = 33.1 bits (74), Expect = 9.5
Identities = 22/92 (23%), Positives = 38/92 (41%)
Frame = -2

Query: 396 EISRSALAHPPNNCCLVLSRSKTFHDSNHYSSLYFPAHTSMHRSKPK*NSCKLVALVGSH 217
E R + N ++ T D +L FP TS + N+CK ++ +H
Sbjct: 31 EAERKRIQDDQNTFAAAMTSEGTSKDLRANDALIFPESTSAEHAPMNINTCKTGLIIQNH 90

Query: 216 HCQDAS*LADGTISLSEISWDSQSQLQTNNKQ 121
+ + + G I + E S +S + +NKQ
Sbjct: 91 N--NGNLCGAGLIGIGEHSSESDERKMDSNKQ 120