BP921809
Clone id YMU001_000154_D08
Library
Length 447
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000154_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGCGAATGCTGGCCCAAATGTCTCCGAATCTGGTAAGAATACATTGACCCTCTGGACTTC
AATGTTTCCTAAGCTGTTCCAAATTTTGTGGGCAGTGAAATGAGACCTGTCGACTGATTC
CCAATCACTGCATTCCACATATTGTTCTCCAAAAGATAATAGGAACCTTCCTCCAGAAAA
ATTGAAACCAAAGACATAAATCTGTGTGTGGCAGCCTGCCTCTAAACTACGAGGGTAAAG
ATCCACTACAAATGGGGCCAACAGATCTTTACAAAACGCACTCGTAGCCTTACCATCTTT
CAAAACTAAGCTCTTCTCAACCAACGGCATAGAAAGTTGCCCAGTTCCAACCAACTTGAC
TCCTTACTTGAGGATAAAAGTCTGCACTTGTCCCTTCCATTCAGCCAATACCTTGTCCCA
CATGACTTGTGGCATTGTAACAAAAAA
■■Homology search results ■■ -
sp_hit_id Q8S9G8
Definition sp|Q8S9G8|SPL7_ARATH Squamosa promoter-binding-like protein 7 OS=Arabidopsis thaliana
Align length 150
Score (bit) 52.8
E-value 7.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921809|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_D08.
(447 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8S9G8|SPL7_ARATH Squamosa promoter-binding-like protein 7 OS... 53 7e-07
sp|Q6I576|SPL9_ORYSJ Squamosa promoter-binding-like protein 9 OS... 47 4e-05
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit... 32 0.93
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subun... 32 0.93
sp|Q3Z4S3|AES_SHISS Acetyl esterase OS=Shigella sonnei (strain S... 32 1.6
sp|Q83M39|AES_SHIFL Acetyl esterase OS=Shigella flexneri GN=aes ... 32 1.6
sp|Q0T7A9|AES_SHIF8 Acetyl esterase OS=Shigella flexneri serotyp... 32 1.6
sp|Q325C0|AES_SHIBS Acetyl esterase OS=Shigella boydii serotype ... 32 1.6
sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain ... 32 1.6
sp|A7ZXD4|AES_ECOHS Acetyl esterase OS=Escherichia coli O9:H4 (s... 32 1.6
sp|Q8XD38|AES_ECO57 Acetyl esterase OS=Escherichia coli O157:H7 ... 32 1.6
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subun... 31 2.7
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subun... 31 2.7
sp|Q8ZRA1|AES_SALTY Acetyl esterase OS=Salmonella typhimurium GN... 30 3.5
sp|Q5PFJ2|AES_SALPA Acetyl esterase OS=Salmonella paratyphi A GN... 30 3.5
sp|Q57S73|AES_SALCH Acetyl esterase OS=Salmonella choleraesuis G... 30 3.5
sp|Q8FK82|AES_ECOL6 Acetyl esterase OS=Escherichia coli O6 GN=ae... 30 4.6
sp|P12657|ACM1_MOUSE Muscarinic acetylcholine receptor M1 OS=Mus... 30 4.6
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protei... 30 4.7
sp|A9MW81|AES_SALPB Acetyl esterase OS=Salmonella paratyphi B (s... 29 7.8
sp|Q3JZN3|Y1668_STRA1 UPF0348 protein SAK_1668 OS=Streptococcus ... 29 8.0
sp|Q8DY37|Y1656_STRA5 UPF0348 protein SAG1656 OS=Streptococcus a... 29 8.0

>sp|Q8S9G8|SPL7_ARATH Squamosa promoter-binding-like protein 7
OS=Arabidopsis thaliana GN=SPL7 PE=1 SV=2
Length = 801

Score = 52.8 bits (125), Expect = 7e-07
Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 3/150 (2%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSL-VLKDGKATSAFCK 268
F+ MP++MW K+ + + FILK G L G G +++ L ++K G
Sbjct: 368 FIAMPEIMWAKLSKDPVAYLDEFILKPGKMLFGRGSMTVYLNNMIFRLIKGGTTLKRVDV 427

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNF--SGGRFLLSFGEQYVECSDWESVDRSHFT 94
L +P + +YP EAG ++ V G N RFL+SF +Y+ ++ V
Sbjct: 428 KLESPKLQFVYPTCFEAGKPIELVVCGQNLLQPKCRFLVSFSGKYLP-HNYSVVPAPDQD 486

Query: 93 AHKIWNSLGNIEVQRVNVFLPDSETFGPAF 4
+ N+ + ++N+ D FGPAF
Sbjct: 487 GKRSCNN----KFYKINIVNSDPSLFGPAF 512


>sp|Q6I576|SPL9_ORYSJ Squamosa promoter-binding-like protein 9
OS=Oryza sativa subsp. japonica GN=SPL9 PE=2 SV=1
Length = 842

Score = 47.0 bits (110), Expect = 4e-05
Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 11/158 (6%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSL-VLKDGKATSAFCK 268
FV MPQ MWDK+ + V++ + L+G G + + VLKDG ++
Sbjct: 410 FVAMPQHMWDKLSEDTGNLVKSLVNAPNSLLLGKGAFFIHVNNMIFQVLKDGATLTSTRL 469

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNFSGGRF--LLSFGEQYVECSDWESVDRSHFT 94
++ +P + ++P EAG + + G + +F L+SF Y++ D
Sbjct: 470 EVQSPRIHYVHPSWFEAGKPIDLILCGSSLDQPKFRSLVSFDGLYLK------HDCRRIL 523

Query: 93 AHKIWNSLGN--------IEVQRVNVFLPDSETFGPAF 4
+H+ ++ +G+ E+ R+N+ +T GPAF
Sbjct: 524 SHETFDCIGSGEHILDSQHEIFRINITTSKLDTHGPAF 561


>sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4
OS=Rattus norvegicus GN=Pik3r4 PE=2 SV=2
Length = 1358

Score = 32.3 bits (72), Expect = 0.93
Identities = 17/44 (38%), Positives = 20/44 (45%)
Frame = +2

Query: 26 ESGKNTLTLWTSMFPKLFQILWAVK*DLSTDSQSLHSTYCSPKD 157
E+G LTLW S P L + L S+H YCSP D
Sbjct: 1216 ETGDRRLTLWASSAPPLSE--------LQPSPHSVHGIYCSPAD 1251


>sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4
OS=Mus musculus GN=Pik3r4 PE=1 SV=3
Length = 1358

Score = 32.3 bits (72), Expect = 0.93
Identities = 17/44 (38%), Positives = 20/44 (45%)
Frame = +2

Query: 26 ESGKNTLTLWTSMFPKLFQILWAVK*DLSTDSQSLHSTYCSPKD 157
E+G LTLW S P L + L S+H YCSP D
Sbjct: 1216 ETGDRRLTLWASSAPPLSE--------LQPSPHSVHGIYCSPAD 1251


>sp|Q3Z4S3|AES_SHISS Acetyl esterase OS=Shigella sonnei (strain
Ss046) GN=aes PE=3 SV=1
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


>sp|Q83M39|AES_SHIFL Acetyl esterase OS=Shigella flexneri GN=aes
PE=3 SV=2
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


>sp|Q0T7A9|AES_SHIF8 Acetyl esterase OS=Shigella flexneri serotype
5b (strain 8401) GN=aes PE=3 SV=1
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


>sp|Q325C0|AES_SHIBS Acetyl esterase OS=Shigella boydii serotype 4
(strain Sb227) GN=aes PE=3 SV=1
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


>sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain
K12) GN=aes PE=1 SV=3
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


>sp|A7ZXD4|AES_ECOHS Acetyl esterase OS=Escherichia coli O9:H4
(strain HS) GN=aes PE=3 SV=1
Length = 319

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/32 (40%), Positives = 17/32 (53%)
Frame = -2

Query: 173 EEGSYYLLENNMWNAVIGNQSTGLISLPTKFG 78
E+ YY LE WNA +T +PTK+G
Sbjct: 39 EQRQYYTLERRFWNAGAPEMATRAYMVPTKYG 70


tr_hit_id B8LQP1
Definition tr|B8LQP1|B8LQP1_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 157
Score (bit) 57.4
E-value 4.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921809|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_D08.
(447 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LQP1|B8LQP1_PICSI Putative uncharacterized protein OS=Picea... 57 4e-07
tr|A7NWA8|A7NWA8_VITVI Chromosome chr5 scaffold_2, whole genome ... 52 1e-05
tr|B8AY86|B8AY86_ORYSI Putative uncharacterized protein OS=Oryza... 47 5e-04
tr|A3B3Y6|A3B3Y6_ORYSJ Putative uncharacterized protein OS=Oryza... 47 5e-04
tr|B1LSG6|B1LSG6_METRJ Bacteriochlorophyll/chlorophyll synthetas... 37 0.48
tr|Q1KUV0|Q1KUV0_9ROSI Putative uncharacterized protein OS=Cleom... 35 1.4
tr|A6L189|A6L189_BACV8 Putative uncharacterized protein OS=Bacte... 35 2.5
tr|B6W1B7|B6W1B7_9BACE Putative uncharacterized protein OS=Bacte... 35 2.5
tr|Q8QRN2|Q8QRN2_9VIRU Nucleocapsid OS=Hantavirus sp. PE=4 SV=1 34 4.1
tr|Q8QRM8|Q8QRM8_9VIRU Nucleocapsid OS=Maciel virus PE=4 SV=1 34 4.1
tr|Q8QRM7|Q8QRM7_9VIRU Nucleocapsid OS=Pergamino virus PE=4 SV=1 34 4.1
tr|Q80DP9|Q80DP9_9VIRU Nucleoprotein OS=Andes virus PE=4 SV=1 34 4.1
tr|O36435|O36435_9VIRU Nucleocapsid protein (Fragment) OS=Andes ... 34 4.1
tr|O36434|O36434_9VIRU Nucleocapsid protein (Fragment) OS=Andes ... 34 4.1
tr|O36307|O36307_9VIRU Nucleoprotein (Nucleocapsid protein) OS=A... 34 4.1
tr|Q99BK5|Q99BK5_9VIRU Nucleocapsid protein OS=Andes virus PE=4 ... 33 5.3
tr|Q8QRN3|Q8QRN3_9VIRU Nucleocapsid OS=Hantavirus sp. PE=4 SV=1 33 5.3
tr|Q8QRN1|Q8QRN1_9VIRU Nucleocapsid OS=Bermejo virus PE=4 SV=1 33 5.3
tr|Q8QRN0|Q8QRN0_9VIRU Nucleocapsid OS=Lechiguanas virus PE=4 SV=1 33 5.3
tr|Q8QRM9|Q8QRM9_9VIRU Nucleocapsid OS=Oran virus PE=4 SV=1 33 5.3
tr|Q4G3H0|Q4G3H0_9VIRU Nucleocapsid protein (Fragment) OS=Arauca... 33 5.3
tr|Q4G3G8|Q4G3G8_9VIRU Nucleocapsid protein OS=Araucaria virus P... 33 5.3
tr|Q4G3G5|Q4G3G5_9VIRU Nucleocapsid protein OS=Araucaria virus P... 33 5.3
tr|Q4G3G1|Q4G3G1_9VIRU Nucleocapsid protein (Fragment) OS=Arauca... 33 5.3
tr|Q4G3G0|Q4G3G0_9VIRU Nucleocapsid protein (Fragment) OS=Arauca... 33 5.3
tr|Q2L976|Q2L976_9VIRU Nucleocapsid protein OS=Neembucu hantavir... 33 5.3
tr|Q2L974|Q2L974_9VIRU Nucleocapsid protein OS=Hantavirus strain... 33 5.3
tr|Q2L973|Q2L973_9VIRU Nucleocapsid protein OS=Hantavirus strain... 33 5.3
tr|A8X5C6|A8X5C6_CAEBR CBR-CPT-1 protein OS=Caenorhabditis brigg... 33 5.5
tr|B2JAL6|B2JAL6_NOSP7 TPR repeat-containing protein OS=Nostoc p... 33 7.2

>tr|B8LQP1|B8LQP1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 997

Score = 57.4 bits (137), Expect = 4e-07
Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 10/157 (6%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSLVLKDGKATSAFCK- 268
F+ +PQ MW+K+ A G + + + L G G + + L + + +K+G+A K
Sbjct: 510 FIALPQFMWEKLFANSPGYIHSLLNGSESILSGKGNMLVYLNDTIMQIKNGEACLVDTKM 569

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNF--SGGRFLLSFGEQYVECSDWESV-----D 109
D+ P ++ ++P S EAG +I G N S RFL+SF Y+ E++
Sbjct: 570 DMRIPKLLSVHPISFEAGYPIEIVACGRNLLQSKYRFLISFHGNYLHYGTCEAIPLGNPG 629

Query: 108 RSHFTAHKIWNSLGNIEVQRVNVFLP--DSETFGPAF 4
S + I++S + + +F+P D FGPAF
Sbjct: 630 SSFRSKENIFHSSNH---ESFKIFIPSTDPRLFGPAF 663


>tr|A7NWA8|A7NWA8_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019851001
PE=4 SV=1
Length = 803

Score = 52.4 bits (124), Expect = 1e-05
Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 6/153 (3%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSL-VLKDGKATSAFCK 268
F+ MP+ MWDK+L + V F+ G L G G + + L V +DG +
Sbjct: 364 FIAMPKFMWDKLLEDPASYVHDFVAAPGKMLSGRGNVLVYLNNMIFRVTEDGTSVMKVEV 423

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNF--SGGRFLLSFGEQYVECSDWESVDRSHFT 94
+ AP + ++P EAG + G N RFL+SF +Y+ D+ V F
Sbjct: 424 KMQAPKLHYVHPNCFEAGKPMEFVACGSNLLRPKFRFLVSFAGKYLS-YDYHVV----FP 478

Query: 93 AHKI-WNSLGNIEVQRVNVFLPDSE--TFGPAF 4
KI ++ G+++ + +++P +E FGPAF
Sbjct: 479 RGKIEGDTAGSLDHEFCKIYIPHTEPNAFGPAF 511


>tr|B8AY86|B8AY86_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19936 PE=4 SV=1
Length = 934

Score = 47.0 bits (110), Expect = 5e-04
Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 11/158 (6%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSL-VLKDGKATSAFCK 268
FV MPQ MWDK+ + V++ + L+G G + + VLKDG ++
Sbjct: 475 FVAMPQHMWDKLSEDTGNLVKSLVNAPNSLLLGKGAFFIHVNNMIFQVLKDGATLTSTRL 534

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNFSGGRF--LLSFGEQYVECSDWESVDRSHFT 94
++ +P + ++P EAG + + G + +F L+SF Y++ D
Sbjct: 535 EVQSPRIHYVHPSWFEAGKPIDLILCGSSLDQPKFRSLVSFDGLYLK------HDCRRIL 588

Query: 93 AHKIWNSLGN--------IEVQRVNVFLPDSETFGPAF 4
+H+ ++ +G+ E+ R+N+ +T GPAF
Sbjct: 589 SHETFDCIGSGEHILDSQHEIFRINITTSKLDTHGPAF 626


>tr|A3B3Y6|A3B3Y6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017758 PE=4 SV=1
Length = 898

Score = 47.0 bits (110), Expect = 5e-04
Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 11/158 (6%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSL-VLKDGKATSAFCK 268
FV MPQ MWDK+ + V++ + L+G G + + VLKDG ++
Sbjct: 485 FVAMPQHMWDKLSEDTGNLVKSLVNAPNSLLLGKGAFFIHVNNMIFQVLKDGATLTSTRL 544

Query: 267 DLLAPFVVDLYPRSLEAGCHTQIYVFGFNFSGGRF--LLSFGEQYVECSDWESVDRSHFT 94
++ +P + ++P EAG + + G + +F L+SF Y++ D
Sbjct: 545 EVQSPRIHYVHPSWFEAGKPIDLILCGSSLDQPKFRSLVSFDGLYLK------HDCRRIL 598

Query: 93 AHKIWNSLGN--------IEVQRVNVFLPDSETFGPAF 4
+H+ ++ +G+ E+ R+N+ +T GPAF
Sbjct: 599 SHETFDCIGSGEHILDSQHEIFRINITTSKLDTHGPAF 636


>tr|B1LSG6|B1LSG6_METRJ Bacteriochlorophyll/chlorophyll synthetase
OS=Methylobacterium radiotolerans (strain ATCC 27329 /
DSM 1819 / JCM 2831) GN=Mrad2831_1852 PE=4 SV=1
Length = 294

Score = 37.0 bits (84), Expect = 0.48
Identities = 20/67 (29%), Positives = 36/67 (53%)
Frame = -2

Query: 272 VKICWPHL*WIFTLVV*RQAATHRFMSLVSIFLEEGSYYLLENNMWNAVIGNQSTGLISL 93
V +C+ L W V A R + LV++ G++ ++ N + +V G++ GL+SL
Sbjct: 144 VALCYEGLPWFTGAAVMAAALPDRRVLLVALLYAAGAHGIMTLNDFKSVEGDRRMGLLSL 203

Query: 92 PTKFGTA 72
P + G+A
Sbjct: 204 PVQMGSA 210


>tr|Q1KUV0|Q1KUV0_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 753

Score = 35.4 bits (80), Expect = 1.4
Identities = 19/57 (33%), Positives = 29/57 (50%)
Frame = -1

Query: 444 FVTMPQVMWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSLVLKDGKATSAF 274
F+ MP++MW K+ + + FILK G L G G +++ L L GK +F
Sbjct: 364 FIAMPEIMWAKLSKDPVAYLDEFILKPGKMLFGRGSMTVYLNNMIFRLMRGKFLVSF 420


>tr|A6L189|A6L189_BACV8 Putative uncharacterized protein
OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 /
NCTC 11154) GN=BVU_1777 PE=4 SV=1
Length = 465

Score = 34.7 bits (78), Expect = 2.5
Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 5/84 (5%)
Frame = -1

Query: 423 MWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSLVLKD-GKATSAFCKDL----L 259
MW K W +L + +G Q V LV ++ GK S+FCK L L
Sbjct: 192 MWVKGFHRW-------MLGVAAQWLGQAQDCANAVAPMLVSREQGKRKSSFCKILMPKEL 244

Query: 258 APFVVDLYPRSLEAGCHTQIYVFG 187
P+ +D + + E+GC ++ +FG
Sbjct: 245 TPYYIDKFDLTSESGCEQKLSLFG 268


>tr|B6W1B7|B6W1B7_9BACE Putative uncharacterized protein
OS=Bacteroides dorei DSM 17855 GN=BACDOR_03306 PE=4 SV=1
Length = 453

Score = 34.7 bits (78), Expect = 2.5
Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 5/84 (5%)
Frame = -1

Query: 423 MWDKVLAEWKGQVQTFILK*GVKLVGTGQLSMPLVEKSLVLKD-GKATSAFCKDL----L 259
MW K W +L + +G Q V LV ++ GK S+FCK L L
Sbjct: 180 MWVKGFHRW-------MLGVAAQWLGQAQDCANAVAPMLVSREQGKRKSSFCKILMPKEL 232

Query: 258 APFVVDLYPRSLEAGCHTQIYVFG 187
P+ +D + + E+GC ++ +FG
Sbjct: 233 TPYYIDKFDLTSESGCEQKLSLFG 256


>tr|Q8QRN2|Q8QRN2_9VIRU Nucleocapsid OS=Hantavirus sp. PE=4 SV=1
Length = 428

Score = 33.9 bits (76), Expect = 4.1
Identities = 23/85 (27%), Positives = 40/85 (47%)
Frame = -2

Query: 275 FVKICWPHL*WIFTLVV*RQAATHRFMSLVSIFLEEGSYYLLENNMWNAVIGNQSTGLIS 96
F +I PH W+F R T +++ V E G+++ + +M N ++ ++S G
Sbjct: 295 FTEIATPHSVWVFACAPDRCPPTALYVAGVP---ELGAFFSILQDMRNTIMASKSVG--- 348

Query: 95 LPTKFGTA*ETLKSRGSMYSYQIRR 21
TA E LK + + Y +RR
Sbjct: 349 ------TAEEKLKKKSAFYQSYLRR 367


>tr|Q8QRM8|Q8QRM8_9VIRU Nucleocapsid OS=Maciel virus PE=4 SV=1
Length = 428

Score = 33.9 bits (76), Expect = 4.1
Identities = 23/85 (27%), Positives = 40/85 (47%)
Frame = -2

Query: 275 FVKICWPHL*WIFTLVV*RQAATHRFMSLVSIFLEEGSYYLLENNMWNAVIGNQSTGLIS 96
F +I PH W+F R T +++ V E G+++ + +M N ++ ++S G
Sbjct: 295 FTEIASPHSVWVFACAPDRCPPTALYVAGVP---ELGAFFAILQDMRNTIMASKSVG--- 348

Query: 95 LPTKFGTA*ETLKSRGSMYSYQIRR 21
TA E LK + + Y +RR
Sbjct: 349 ------TAEEKLKKKSAFYQSYLRR 367