BP921826
Clone id YMU001_000154_F04
Library
Length 502
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000154_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATAACAGCGCATGGCCGCACAGATCCAGCGCAAACAACAGGATTTGTGTTTGAAGATTG
CATTATCAATGGGACAAATGAGTTTATGGAGAGCTTTATACTGAATCCAAAGAAATACAA
GGTTTACCTAGGGCGTCCATGGAAGCCGTGTTTCAAGAACTATTTACAAAAGTTCGTGGA
TTGAGAGAGTTGTGAGGCCAGAAGGATGGCGTCCGTGGAGAGGGGATTTTGCTTTGAGCA
CACTTTTCTATGGTGAGTACAATAATATGGGCATTGGTGCTGGTTTTGAAGGTAGAGTTA
ATTGGGCAGAGCAAATATCGTCTTCAATGGCCATGCTGTATACAGTGTCAAATTTTATTC
AAGGGGATGAGTGGCTTTTAGACTTTGTCACCAAATAAACAGGTGCCCAAGGATTTCTTT
ATTATATGCTTGCCTTATCAACAAGGGTAGGCATTTTGTAGGCATACAGGCTGTGATCGT
CTTTTCATGTCAAATTCTAAGT
■■Homology search results ■■ -
sp_hit_id Q43143
Definition sp|Q43143|PMEU1_SOLLC Pectinesterase U1 OS=Solanum lycopersicum
Align length 78
Score (bit) 77.8
E-value 2.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921826|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_F04.
(502 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q43143|PMEU1_SOLLC Pectinesterase U1 OS=Solanum lycopersicum ... 78 2e-22
sp|Q43062|PME_PRUPE Pectinesterase PPE8B OS=Prunus persica PE=2 ... 85 3e-21
sp|P83218|PME_DAUCA Pectinesterase OS=Daucus carota PE=1 SV=1 76 3e-20
sp|O04886|PME1_CITSI Pectinesterase-1 OS=Citrus sinensis GN=PECS... 75 1e-19
sp|Q42534|PME2_ARATH Pectinesterase-2 OS=Arabidopsis thaliana GN... 69 2e-19
sp|P83948|PME3_CITSI Pectinesterase-3 OS=Citrus sinensis PE=1 SV=1 76 2e-19
sp|P83947|PME1_FICAW Pectinesterase OS=Ficus awkeotsang PE=1 SV=1 73 2e-19
sp|Q96575|PME22_SOLLC Pectinesterase-2 OS=Solanum lycopersicum G... 73 4e-19
sp|P14280|PME1_SOLLC Pectinesterase-1 OS=Solanum lycopersicum GN... 73 4e-19
sp|P09607|PME21_SOLLC Pectinesterase-2 OS=Solanum lycopersicum G... 74 6e-19
sp|P85076|PME_ACTDE Pectinesterase OS=Actinidia deliciosa PE=1 SV=1 76 6e-19
sp|O04887|PME2_CITSI Pectinesterase-2 OS=Citrus sinensis GN=PECS... 75 1e-13
sp|Q96576|PME3_SOLLC Pectinesterase-3 OS=Solanum lycopersicum GN... 74 4e-13
sp|Q43111|PME3_PHAVU Pectinesterase-3 OS=Phaseolus vulgaris GN=M... 55 2e-11
sp|Q43867|PME1_ARATH Pectinesterase-1 OS=Arabidopsis thaliana GN... 51 7e-11
sp|Q43043|PME_PETIN Pectinesterase OS=Petunia integrifolia GN=PP... 60 7e-09
sp|Q5MFV8|PME5_ARATH Pectinesterase-5 OS=Arabidopsis thaliana GN... 54 3e-08
sp|O80722|PME4_ARATH Pectinesterase-4 OS=Arabidopsis thaliana GN... 53 5e-08
sp|P41510|PME_BRANA Probable pectinesterase OS=Brassica napus GN... 49 6e-08
sp|Q42608|PME_BRACM Pectinesterase (Fragment) OS=Brassica campes... 48 6e-08
sp|Q5MFV6|PMEL_ARATH Probable pectinesterase VGDH2 OS=Arabidopsi... 49 6e-07
sp|Q42920|PME_MEDSA Pectinesterase OS=Medicago sativa PE=2 SV=1 47 8e-07
sp|Q91ZR7|S35A4_RAT Probable UDP-sugar transporter protein SLC35... 30 4.8
sp|Q05B73|S35A4_BOVIN Probable UDP-sugar transporter protein SLC... 30 4.8
sp|Q5RA79|S35A4_PONAB Probable UDP-sugar transporter protein SLC... 30 6.3
sp|Q9D321|S35A4_MOUSE Probable UDP-sugar transporter protein SLC... 30 8.2
sp|Q96G79|S35A4_HUMAN Probable UDP-sugar transporter protein SLC... 30 8.2
sp|Q5HM33|NPD_STAEQ NAD-dependent deacetylase OS=Staphylococcus ... 30 8.3

>sp|Q43143|PMEU1_SOLLC Pectinesterase U1 OS=Solanum lycopersicum
GN=PMEU1 PE=2 SV=1
Length = 583

Score = 77.8 bits (190), Expect(2) = 2e-22
Identities = 39/78 (50%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---ISS 323
SRT+ S I V++P GW W G+FAL TLFYGEY N G GA GRV W SS
Sbjct: 495 SRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTSGRVKWKGHKVITSS 554

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A YT FI G WL
Sbjct: 555 TEAQAYTPGRFIAGGSWL 572



Score = 47.4 bits (111), Expect(2) = 2e-22
Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNP--KKYKVYLGRPWK 145
+TA GRTDP Q TG V + C I T++ L P K + YLGRPWK
Sbjct: 449 VTAQGRTDPNQNTGIVIQKCRIGATSD------LRPVQKSFPTYLGRPWK 492


>sp|Q43062|PME_PRUPE Pectinesterase PPE8B OS=Prunus persica PE=2
SV=1
Length = 522

Score = 84.7 bits (208), Expect(2) = 3e-21
Identities = 41/78 (52%), Positives = 52/78 (66%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNW-AEQI--SS 323
SRT+ S++ V+RPEGW W GDFAL++LFYGEY N G GAG RV W Q+ S
Sbjct: 432 SRTVIMQSFLSNVIRPEGWLEWNGDFALNSLFYGEYMNYGPGAGLGSRVKWPGYQVFNES 491

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A YTV+ FI+G+ WL
Sbjct: 492 TQAKNYTVAQFIEGNLWL 509



Score = 36.6 bits (83), Expect(2) = 3e-21
Identities = 20/48 (41%), Positives = 27/48 (56%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
ITA GR DP + TG + C I ++ +E+ +N YLGRPWK
Sbjct: 385 ITAQGRKDPNEPTGISIQFCNITADSD-LEAASVN--STPTYLGRPWK 429


>sp|P83218|PME_DAUCA Pectinesterase OS=Daucus carota PE=1 SV=1
Length = 319

Score = 76.3 bits (186), Expect(2) = 3e-20
Identities = 38/78 (48%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNW---AEQISS 323
SRT+ S I V+ P GW PW G+FAL TL+YGEY N G GA GRV W SS
Sbjct: 231 SRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSS 290

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A +T +FI G WL
Sbjct: 291 TEAQGFTPGSFIAGGSWL 308



Score = 41.6 bits (96), Expect(2) = 3e-20
Identities = 20/48 (41%), Positives = 25/48 (52%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TA GRTDP Q TG V + I T++ + YLGRPWK
Sbjct: 185 VTAQGRTDPNQNTGIVIQKSRIGATSDLQPV----QSSFPTYLGRPWK 228


>sp|O04886|PME1_CITSI Pectinesterase-1 OS=Citrus sinensis
GN=PECS-1.1 PE=2 SV=1
Length = 584

Score = 74.7 bits (182), Expect(2) = 1e-19
Identities = 36/78 (46%), Positives = 46/78 (58%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNW---AEQISS 323
SRT+ S I ++ P GW W G+FAL+TLFYGE+ N G GAG GRV W S+
Sbjct: 496 SRTVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSA 555

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A +T +FI G WL
Sbjct: 556 TEAQAFTPGSFIAGSSWL 573



Score = 41.2 bits (95), Expect(2) = 1e-19
Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKK--YKVYLGRPWK 145
+TA GRTDP Q TG V + I T++ L P + + YLGRPWK
Sbjct: 450 VTAQGRTDPNQNTGIVIQKSRIGATSD------LKPVQGSFPTYLGRPWK 493


>sp|Q42534|PME2_ARATH Pectinesterase-2 OS=Arabidopsis thaliana
GN=PME2 PE=2 SV=2
Length = 587

Score = 68.9 bits (167), Expect(2) = 2e-19
Identities = 37/78 (47%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---ISS 323
SRT+ S I V+RPEGW W G FAL TL Y EY N G GAG RV W S
Sbjct: 499 SRTVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSD 558

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A +T FI G WL
Sbjct: 559 TEAQPFTAGQFIGGGGWL 576



Score = 46.6 bits (109), Expect(2) = 2e-19
Identities = 21/48 (43%), Positives = 29/48 (60%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TA GR+DP Q TG V ++C I GT++ + + YLGRPWK
Sbjct: 453 VTAQGRSDPNQNTGIVIQNCRIGGTSDLLAV----KGTFPTYLGRPWK 496


>sp|P83948|PME3_CITSI Pectinesterase-3 OS=Citrus sinensis PE=1 SV=1
Length = 584

Score = 75.9 bits (185), Expect(2) = 2e-19
Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNW---AEQISS 323
SRT+ S I V+ P GW W G+FAL+TLFYGE+ N G GAG GRV W S+
Sbjct: 496 SRTVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSA 555

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ A +T +FI G WL
Sbjct: 556 TEAQAFTPGSFIAGSSWL 573



Score = 39.3 bits (90), Expect(2) = 2e-19
Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKK--YKVYLGRPWK 145
+TA GR DP Q TG V + I T++ L P + + YLGRPWK
Sbjct: 450 VTAQGRADPNQNTGIVIQKSRIGATSD------LKPVQGSFPTYLGRPWK 493


>sp|P83947|PME1_FICAW Pectinesterase OS=Ficus awkeotsang PE=1 SV=1
Length = 545

Score = 72.8 bits (177), Expect(2) = 2e-19
Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---ISS 323
SRT+ S+I V+ P GW W DFAL TLFYGEY N G G+G RV W S
Sbjct: 455 SRTVVMESYISDVIDPAGWLEWDRDFALKTLFYGEYRNGGPGSGTSERVKWPGYHVITSP 514

Query: 324 SMAMLYTVSNFIQGDEWL 377
+A +TV+ IQG WL
Sbjct: 515 EVAEQFTVAELIQGGSWL 532



Score = 42.4 bits (98), Expect(2) = 2e-19
Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKK--YKVYLGRPWK 145
ITA GRTDP Q TG ++C E S L P + +K YLGRPWK
Sbjct: 409 ITAQGRTDPNQNTGTSIQNC------EIFASADLEPVEDTFKSYLGRPWK 452


>sp|Q96575|PME22_SOLLC Pectinesterase-2 OS=Solanum lycopersicum
GN=PME2 PE=3 SV=1
Length = 550

Score = 72.8 bits (177), Expect(2) = 4e-19
Identities = 35/80 (43%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
Frame = +3

Query: 147 RVSRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---I 317
+ SRT+ S++ ++ P GW W GDFAL TL+YGE+ N G GAG RV W
Sbjct: 458 KYSRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHCIT 517

Query: 318 SSSMAMLYTVSNFIQGDEWL 377
+ AM +TV+ IQG WL
Sbjct: 518 DPAEAMPFTVAKLIQGGSWL 537



Score = 41.2 bits (95), Expect(2) = 4e-19
Identities = 21/48 (43%), Positives = 30/48 (62%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TA GRTDP Q TG + C I +++ +E + K++ YLGRPWK
Sbjct: 414 VTAQGRTDPNQATGTSIQFCNIIASSD-LEPVL---KEFPTYLGRPWK 457


>sp|P14280|PME1_SOLLC Pectinesterase-1 OS=Solanum lycopersicum
GN=PME1.9 PE=1 SV=5
Length = 546

Score = 72.8 bits (177), Expect(2) = 4e-19
Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---ISS 323
SRT+ S++ ++ P GW W GDFAL TL+YGE+ N G GAG RV W
Sbjct: 456 SRTVVMESYLGGLINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDP 515

Query: 324 SMAMLYTVSNFIQGDEWL 377
+ AM +TV+ IQG WL
Sbjct: 516 AKAMPFTVAKLIQGGSWL 533



Score = 41.2 bits (95), Expect(2) = 4e-19
Identities = 21/48 (43%), Positives = 30/48 (62%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TA GRTDP Q TG + C I +++ +E + K++ YLGRPWK
Sbjct: 410 VTAQGRTDPNQATGTSIQFCNIIASSD-LEPVL---KEFPTYLGRPWK 453


>sp|P09607|PME21_SOLLC Pectinesterase-2 OS=Solanum lycopersicum
GN=PME2.1 PE=2 SV=2
Length = 550

Score = 73.6 bits (179), Expect(2) = 6e-19
Identities = 35/80 (43%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
Frame = +3

Query: 147 RVSRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQ---I 317
+ SRT+ S++ ++ P GW W GDFAL TL+YGE+ N G GAG RV W
Sbjct: 458 KYSRTVVMESYLGGLIDPSGWAEWHGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVIT 517

Query: 318 SSSMAMLYTVSNFIQGDEWL 377
+ AM +TV+ IQG WL
Sbjct: 518 DPAEAMSFTVAKLIQGGSWL 537



Score = 40.0 bits (92), Expect(2) = 6e-19
Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNP--KKYKVYLGRPWK 145
+TA GRTDP Q TG + C + + S L P K++ YLGRPWK
Sbjct: 414 VTAQGRTDPNQATGTSIQFC------DIIASPDLKPVVKEFPTYLGRPWK 457


tr_hit_id A9NUI7
Definition tr|A9NUI7|A9NUI7_PICSI Pectinesterase OS=Picea sitchensis
Align length 75
Score (bit) 94.7
E-value 1.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921826|Adiantum capillus-veneris mRNA, clone:
YMU001_000154_F04.
(502 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUI7|A9NUI7_PICSI Pectinesterase OS=Picea sitchensis PE=2 SV=1 95 1e-36
tr|A7QB79|A7QB79_VITVI Chromosome chr4 scaffold_73, whole genome... 96 7e-36
tr|A7QB80|A7QB80_VITVI Chromosome chr4 scaffold_73, whole genome... 93 1e-35
tr|A7QB78|A7QB78_VITVI Chromosome chr4 scaffold_73, whole genome... 89 4e-33
tr|A0ZNK0|A0ZNK0_PYRCO Pectin methylesterase 2 (Fragment) OS=Pyr... 88 5e-33
tr|Q96497|Q96497_SILPR Pectin methylesterase (Fragment) OS=Silen... 91 5e-33
tr|B7FLZ2|B7FLZ2_MEDTR Putative uncharacterized protein OS=Medic... 85 9e-33
tr|Q8LD76|Q8LD76_ARATH Pectin methylesterase-like protein OS=Ara... 87 3e-31
tr|Q01I60|Q01I60_ORYSA Pectinesterase OS=Oryza sativa GN=H0315A0... 92 6e-31
tr|A2XTR1|A2XTR1_ORYSI Pectinesterase OS=Oryza sativa subsp. ind... 92 6e-31
tr|Q9FLF6|Q9FLF6_ARATH Pectin methylesterase-like protein OS=Ara... 87 1e-30
tr|Q8L7Q7|Q8L7Q7_ARATH Pectin methylesterase-like protein OS=Ara... 87 1e-30
tr|Q9FXW9|Q9FXW9_ARATH Pectin methylesterase-like protein OS=Ara... 85 1e-30
tr|Q9LXD9|Q9LXD9_ARATH Pectin methylesterase-like protein OS=Ara... 85 1e-30
tr|B4FRR6|B4FRR6_MAIZE Putative uncharacterized protein OS=Zea m... 91 5e-30
tr|Q7XRA7|Q7XRA7_ORYSJ Pectinesterase OS=Oryza sativa subsp. jap... 88 6e-30
tr|Q0JD10|Q0JD10_ORYSJ Pectinesterase (Fragment) OS=Oryza sativa... 88 6e-30
tr|Q8LJK2|Q8LJK2_ORYSJ Pectinesterase OS=Oryza sativa subsp. jap... 80 1e-26
tr|A2WXL1|A2WXL1_ORYSI Pectinesterase OS=Oryza sativa subsp. ind... 80 1e-26
tr|A7PDP3|A7PDP3_VITVI Pectinesterase OS=Vitis vinifera GN=GSVIV... 89 6e-23
tr|Q9M9W6|Q9M9W6_ARATH Putative pectinesterase OS=Arabidopsis th... 77 2e-22
tr|Q8GX86|Q8GX86_ARATH Putative pectinesterase (At3g05610) OS=Ar... 77 2e-22
tr|Q9SEE6|Q9SEE6_SOLTU Pectinesterase OS=Solanum tuberosum GN=Pe... 79 8e-22
tr|Q564D7|Q564D7_SOLLC Pectinesterase OS=Solanum lycopersicum GN... 78 2e-21
tr|Q3E8Z8|Q3E8Z8_ARATH Uncharacterized protein At5g27870.1 OS=Ar... 74 4e-21
tr|A7PYC6|A7PYC6_VITVI Pectinesterase OS=Vitis vinifera GN=GSVIV... 82 4e-21
tr|A9YY06|A9YY06_DENCR Pectinesterase (Fragment) OS=Dendrobium c... 81 4e-21
tr|A2Q3Z3|A2Q3Z3_MEDTR Pectinesterase OS=Medicago truncatula GN=... 82 4e-21
tr|B7SIX2|B7SIX2_9CONI Pectin methylesterase-like protein OS=Tai... 79 9e-21
tr|B6SZL3|B6SZL3_MAIZE Pectinesterase-2 OS=Zea mays PE=2 SV=1 86 1e-20

>tr|A9NUI7|A9NUI7_PICSI Pectinesterase OS=Picea sitchensis PE=2 SV=1
Length = 559

Score = 94.7 bits (234), Expect(2) = 1e-36
Identities = 41/75 (54%), Positives = 53/75 (70%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SR I+ +S++ ++ PEGW PW GDFAL TL+YGEY N G GA GRV W+ QI A
Sbjct: 480 SRVIFMNSYLGELIVPEGWMPWTGDFALDTLYYGEYQNYGPGAKVSGRVPWSNQIPKINA 539

Query: 333 MLYTVSNFIQGDEWL 377
Y++++FIQGDEWL
Sbjct: 540 GKYSINSFIQGDEWL 554



Score = 81.6 bits (200), Expect(2) = 1e-36
Identities = 34/48 (70%), Positives = 39/48 (81%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TAHGRTDPAQ TGFVF +C INGT E+M+ + NPK YK YLGRPWK
Sbjct: 430 VTAHGRTDPAQPTGFVFHNCTINGTEEYMKEYYSNPKIYKAYLGRPWK 477


>tr|A7QB79|A7QB79_VITVI Chromosome chr4 scaffold_73, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034841001
PE=3 SV=1
Length = 404

Score = 96.3 bits (238), Expect(2) = 7e-36
Identities = 39/75 (52%), Positives = 53/75 (70%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ +E +V P+GW PW GDFAL TL+YGE+NN G+GA RV W+ QI +
Sbjct: 326 SRTVFIQCLLEALVTPQGWLPWSGDFALETLYYGEFNNSGLGANLSARVTWSSQIPAQHI 385

Query: 333 MLYTVSNFIQGDEWL 377
+Y+V NFIQG+EW+
Sbjct: 386 NMYSVQNFIQGNEWI 400



Score = 77.8 bits (190), Expect(2) = 7e-36
Identities = 30/48 (62%), Positives = 42/48 (87%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TAH RTDPAQTTGFVF++C++NGT+++M+ + NPK +K +LGRPWK
Sbjct: 276 VTAHSRTDPAQTTGFVFQNCVVNGTDDYMKLYYSNPKVHKNFLGRPWK 323


>tr|A7QB80|A7QB80_VITVI Chromosome chr4 scaffold_73, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034843001
PE=3 SV=1
Length = 377

Score = 92.8 bits (229), Expect(2) = 1e-35
Identities = 38/75 (50%), Positives = 52/75 (69%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ ++E +V P+GW PW GDFAL TL+YGE+NN G+GA RV W+ QI +
Sbjct: 299 SRTVFIRCFLEPLVTPQGWLPWSGDFALKTLYYGEFNNSGLGASLSARVTWSSQIPAQHL 358

Query: 333 MLYTVSNFIQGDEWL 377
Y+V NFIQG+ W+
Sbjct: 359 NTYSVQNFIQGNGWI 373



Score = 80.1 bits (196), Expect(2) = 1e-35
Identities = 31/48 (64%), Positives = 43/48 (89%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TAHGRTDPAQTTGFVF++C++NGT+++M+ + NPK +K +LGRPWK
Sbjct: 249 VTAHGRTDPAQTTGFVFQNCVVNGTDDYMKLYYSNPKVHKNFLGRPWK 296


>tr|A7QB78|A7QB78_VITVI Chromosome chr4 scaffold_73, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034839001
PE=3 SV=1
Length = 553

Score = 89.4 bits (220), Expect(2) = 4e-33
Identities = 36/75 (48%), Positives = 51/75 (68%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ +E ++ P GW PW GDFAL+TL+YGE+ N G+GA RV W+ +I +
Sbjct: 466 SRTVFIHCNLEVLITPPGWMPWSGDFALATLYYGEFENRGLGANLSSRVEWSSRIPAKHV 525

Query: 333 MLYTVSNFIQGDEWL 377
Y++ NFIQGDEW+
Sbjct: 526 GTYSLKNFIQGDEWI 540



Score = 75.5 bits (184), Expect(2) = 4e-33
Identities = 30/48 (62%), Positives = 40/48 (83%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+TAHGRTDPAQTTG VF++C++NGT E+M+ + NP +K +LGRPWK
Sbjct: 416 VTAHGRTDPAQTTGLVFQNCVVNGTEEYMKLYHSNPTVHKNFLGRPWK 463


>tr|A0ZNK0|A0ZNK0_PYRCO Pectin methylesterase 2 (Fragment) OS=Pyrus
communis GN=PcPME2 PE=2 SV=1
Length = 575

Score = 87.8 bits (216), Expect(2) = 5e-33
Identities = 37/75 (49%), Positives = 49/75 (65%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ +S +E +V P+GW PW GDFAL TLFYGE+ N G G+ RV W+ +I
Sbjct: 499 SRTVFINSSMEALVAPQGWMPWDGDFALKTLFYGEFGNSGAGSDLSQRVKWSSKIPPEHV 558

Query: 333 MLYTVSNFIQGDEWL 377
Y+ NFI GDEW+
Sbjct: 559 NTYSQQNFIDGDEWI 573



Score = 76.6 bits (187), Expect(2) = 5e-33
Identities = 32/48 (66%), Positives = 41/48 (85%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
ITAHGRTDP Q+TGFVFE+C+INGT+E+M+ + P+ +K YLGRPWK
Sbjct: 449 ITAHGRTDPGQSTGFVFENCLINGTDEYMKLYRSKPQVHKNYLGRPWK 496


>tr|Q96497|Q96497_SILPR Pectin methylesterase (Fragment) OS=Silene
pratensis PE=2 SV=1
Length = 379

Score = 90.9 bits (224), Expect(2) = 5e-33
Identities = 38/75 (50%), Positives = 49/75 (65%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT+Y + +E ++ PEGW PW GDFALSTL+YGE+ N G GA RV W+ +
Sbjct: 301 SRTVYINCTMESLIAPEGWLPWSGDFALSTLYYGEFGNSGPGANVSSRVPWSRLVPEEHV 360

Query: 333 MLYTVSNFIQGDEWL 377
Y V NF+QGDEW+
Sbjct: 361 STYYVENFLQGDEWI 375



Score = 73.6 bits (179), Expect(2) = 5e-33
Identities = 31/48 (64%), Positives = 38/48 (79%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
I AHGRTDPAQTTGF F C+INGT+++M+ + P K+K YLGRPWK
Sbjct: 251 IAAHGRTDPAQTTGFAFLGCLINGTDDYMKLYHSKPSKHKNYLGRPWK 298


>tr|B7FLZ2|B7FLZ2_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 238

Score = 85.1 bits (209), Expect(2) = 9e-33
Identities = 35/75 (46%), Positives = 50/75 (66%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ S +E +V P+GW PW GDFAL TL+YGE+ N G G+ RV+W+ +I +
Sbjct: 143 SRTVFIHSILEVLVTPQGWMPWSGDFALKTLYYGEFENSGAGSDLSQRVSWSSKIPAEHV 202

Query: 333 MLYTVSNFIQGDEWL 377
Y+ +FIQG EW+
Sbjct: 203 SSYSAEDFIQGGEWM 217



Score = 78.6 bits (192), Expect(2) = 9e-33
Identities = 33/48 (68%), Positives = 41/48 (85%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
ITAHGRTDPAQ+TGFVF++C+INGT ++M + NPK +K YLGRPWK
Sbjct: 93 ITAHGRTDPAQSTGFVFQNCLINGTEDYMALYHSNPKVHKNYLGRPWK 140


>tr|Q8LD76|Q8LD76_ARATH Pectin methylesterase-like protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 222

Score = 87.0 bits (214), Expect(2) = 3e-31
Identities = 36/74 (48%), Positives = 50/74 (67%)
Frame = +3

Query: 153 SRTIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMA 332
SRT++ + +E ++ P+GW PW GDFAL TL+YGEY N G G+ RV W+ +I
Sbjct: 144 SRTVFVNCNLESLISPDGWMPWNGDFALKTLYYGEYKNTGPGSVRSSRVPWSSEIPEKHV 203

Query: 333 MLYTVSNFIQGDEW 374
+Y+V+NFIQ DEW
Sbjct: 204 DVYSVANFIQADEW 217



Score = 71.2 bits (173), Expect(2) = 3e-31
Identities = 30/48 (62%), Positives = 39/48 (81%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
ITAHGR D +Q+TGFVF +C INGT E+M+ F NP+++K +LGRPWK
Sbjct: 94 ITAHGRIDASQSTGFVFLNCSINGTEEYMKEFQANPERHKNFLGRPWK 141


>tr|Q01I60|Q01I60_ORYSA Pectinesterase OS=Oryza sativa
GN=H0315A08.12 PE=3 SV=1
Length = 478

Score = 91.7 bits (226), Expect(2) = 6e-31
Identities = 37/73 (50%), Positives = 51/73 (69%)
Frame = +3

Query: 159 TIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMAML 338
T+Y ++ +VVRPEGW PWRG+FAL TL+YGE+++ G GA RV W+ Q + +
Sbjct: 404 TVYAGCYLGKVVRPEGWLPWRGEFALRTLYYGEFDSRGPGANHTARVEWSSQAPEQLVGV 463

Query: 339 YTVSNFIQGDEWL 377
Y+V NFIQG EW+
Sbjct: 464 YSVENFIQGHEWI 476



Score = 65.9 bits (159), Expect(2) = 6e-31
Identities = 26/48 (54%), Positives = 36/48 (75%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+ A+GR DP QTTGFVF +C ++G+ EF+ F P+ Y++YLGRPWK
Sbjct: 352 VAANGRIDPGQTTGFVFWNCTLDGSKEFLALFRAKPESYRLYLGRPWK 399


>tr|A2XTR1|A2XTR1_ORYSI Pectinesterase OS=Oryza sativa subsp. indica
GN=OsI_15995 PE=3 SV=1
Length = 480

Score = 91.7 bits (226), Expect(2) = 6e-31
Identities = 37/73 (50%), Positives = 51/73 (69%)
Frame = +3

Query: 159 TIYKSSWIERVVRPEGWRPWRGDFALSTLFYGEYNNMGIGAGFEGRVNWAEQISSSMAML 338
T+Y ++ +VVRPEGW PWRG+FAL TL+YGE+++ G GA RV W+ Q + +
Sbjct: 406 TVYAGCYLGKVVRPEGWLPWRGEFALRTLYYGEFDSRGPGANHTARVEWSSQAPEQLVGV 465

Query: 339 YTVSNFIQGDEWL 377
Y+V NFIQG EW+
Sbjct: 466 YSVENFIQGHEWI 478



Score = 65.9 bits (159), Expect(2) = 6e-31
Identities = 26/48 (54%), Positives = 36/48 (75%)
Frame = +2

Query: 2 ITAHGRTDPAQTTGFVFEDCIINGTNEFMESFILNPKKYKVYLGRPWK 145
+ A+GR DP QTTGFVF +C ++G+ EF+ F P+ Y++YLGRPWK
Sbjct: 354 VAANGRIDPGQTTGFVFWNCTLDGSKEFLALFRAKPESYRLYLGRPWK 401